Campus Alert Archive
Ivy Tech

Valpo campus multi-day virtual ops for HVAC issues

AI-generated · every claim is source-linked
INfacility emergencyemergency notificationhigh confidence
Compare →

Ivy Tech shifted Valpo campus to virtual operations for HVAC issues through a multi-day reopen.

Alerts
1
Response
—
Killed
—
Injured
—
Institution
Ivy Tech Community College
Community College · IN
All Ivy Tech cases →
~160,000 studentsIvyAlert / @IvyTechCC
Official alert policy
Read when and how Ivy Tech says it will use IvyAlert (Rave): summarized, quoted, and analyzed.
Documented Timeline

Alert Sequence

1 message in sequence · 1 verified verbatim

Confirmed wording is transcribed character-for-character from a primary source. Use Verify this quote under each message to open that source in a new tab and compare the text yourself.

INITIAL ALERTTwitter/X
Verified verbatim141 chars
Urgent IvyAlert Valpo: Campus will operate virtually starting at 1:00 PM, 7/2/26 due to HVAC issues. Campus will reopen on 7/6/26 at 7:00 AM.
Verify this quote
@IvyTechCCx.comfind archived copies
Dual independent X fetch match (keyword + thread_fetch) 2026-08-03; second blind sha256 match.
SPN 523 at capture (web.archive.org/save returned 523).
Distinct incident from 2026-07-01-ivy-tech-valpo-afternoon-power-outage-virtual: adjacent calendar day but different hazard (HVAC cooling vs power loss), different reopen date, distinct status IDs.
Message elements

How the first alert is built

To check this alert, SuperGrok Heavy 4.5 (an AI) read it in full 25 separate times, independently. Each read decided whether the message answers each of the six questions and gave a short reason. A final reviewer then weighed all 25 and wrote the plain-English verdict you see when you open a row. The score (for example 22/25) is how many reads agreed; the 25 individual reads are tucked underneath if you want to check them.

Urgent IvyAlert Valpo: Campus will operate virtually starting at 1:00 PM, 7/2/26 due to HVAC issues. Campus will reopen on 7/6/26 at 7:00 AM.

  • Sourcepresent25/25

    Final assessment

    Majority (25/25) mark S present.

    Who is sending the alert and who is responding. People act faster on a message from a clearly identifiable, credible sender, such as a named department, the police, or a branded alert system, than on an anonymous notice. A branded signature counts.

    See all 25 individual reads
    1. present: Branded Urgent IvyAlert Valpo identifies the sender.
    2. present: Pass: Branded Urgent IvyAlert Valpo identifies the sender.
    3. present: Text-only: Branded Urgent IvyAlert Valpo identifies the sender.
    4. present: Judgment: Branded Urgent IvyAlert Valpo identifies the sender. Independent (pass 4).
    5. present: Read: Branded Urgent IvyAlert Valpo identifies the sender. Independent.
    6. present: Independent: Branded Urgent IvyAlert Valpo identifies the sender. Independent.
    7. present: Note: Branded Urgent IvyAlert Valpo identifies the sender. From text alone.
    8. present: Code: Branded Urgent IvyAlert Valpo identifies the sender. From text alone.
    9. present: Branded Urgent IvyAlert Valpo identifies the sender. From text alone.
    10. present: Pass: Branded Urgent IvyAlert Valpo identifies the sender. Per rubric.
    11. present: Text-only: Branded Urgent IvyAlert Valpo identifies the sender. Per rubric (pass 11).
    12. present: Judgment: Branded Urgent IvyAlert Valpo identifies the sender. Per rubric.
    13. present: Read: Branded Urgent IvyAlert Valpo identifies the sender.
    14. present: Independent: Branded Urgent IvyAlert Valpo identifies the sender.
    15. present: Note: Branded Urgent IvyAlert Valpo identifies the sender.
    16. present: Code: Branded Urgent IvyAlert Valpo identifies the sender. Independent.
    17. present: Branded Urgent IvyAlert Valpo identifies the sender. Independent.
    18. present: Pass: Branded Urgent IvyAlert Valpo identifies the sender. Independent (pass 18).
    19. present: Text-only: Branded Urgent IvyAlert Valpo identifies the sender. From text alone.
    20. present: Judgment: Branded Urgent IvyAlert Valpo identifies the sender. From text alone.
    21. present: Read: Branded Urgent IvyAlert Valpo identifies the sender. From text alone.
    22. present: Independent: Branded Urgent IvyAlert Valpo identifies the sender. Per rubric.
    23. present: Note: Branded Urgent IvyAlert Valpo identifies the sender. Per rubric.
    24. present: Code: Branded Urgent IvyAlert Valpo identifies the sender. Per rubric.
    25. present: Branded Urgent IvyAlert Valpo identifies the sender (pass 25).
  • Hazardpresent25/25

    Final assessment

    Majority (25/25) mark H present.

    What the threat actually is. A complete warning names the specific danger, such as a shooter, a fire, a tornado, or a gas leak, rather than a vague emergency, because people decide what to do based on what they are facing.

    See all 25 individual reads
    1. present: Names HVAC issues as the hazard.
    2. present: Pass: Names HVAC issues as the hazard.
    3. present: Text-only: Names HVAC issues as the hazard.
    4. present: Judgment: Names HVAC issues as the hazard. Independent (pass 4).
    5. present: Read: Names HVAC issues as the hazard. Independent.
    6. present: Independent: Names HVAC issues as the hazard. Independent.
    7. present: Note: Names HVAC issues as the hazard. From text alone.
    8. present: Code: Names HVAC issues as the hazard. From text alone.
    9. present: Names HVAC issues as the hazard. From text alone.
    10. present: Pass: Names HVAC issues as the hazard. Per rubric.
    11. present: Text-only: Names HVAC issues as the hazard. Per rubric (pass 11).
    12. present: Judgment: Names HVAC issues as the hazard. Per rubric.
    13. present: Read: Names HVAC issues as the hazard.
    14. present: Independent: Names HVAC issues as the hazard.
    15. present: Note: Names HVAC issues as the hazard.
    16. present: Code: Names HVAC issues as the hazard. Independent.
    17. present: Names HVAC issues as the hazard. Independent.
    18. present: Pass: Names HVAC issues as the hazard. Independent (pass 18).
    19. present: Text-only: Names HVAC issues as the hazard. From text alone.
    20. present: Judgment: Names HVAC issues as the hazard. From text alone.
    21. present: Read: Names HVAC issues as the hazard. From text alone.
    22. present: Independent: Names HVAC issues as the hazard. Per rubric.
    23. present: Note: Names HVAC issues as the hazard. Per rubric.
    24. present: Code: Names HVAC issues as the hazard. Per rubric.
    25. present: Names HVAC issues as the hazard (pass 25).
  • Locationpresent25/25

    Final assessment

    Majority (25/25) mark L present.

    Where the threat is. Saying whether danger is in a specific building, a part of campus, or area-wide lets people judge their own proximity and choose a safe direction. Without a where, a warning is hard to act on precisely.

    See all 25 individual reads
    1. present: Names Valpo campus.
    2. present: Pass: Names Valpo campus.
    3. present: Text-only: Names Valpo campus.
    4. present: Judgment: Names Valpo campus. Independent (pass 4).
    5. present: Read: Names Valpo campus. Independent.
    6. present: Independent: Names Valpo campus. Independent.
    7. present: Note: Names Valpo campus. From text alone.
    8. present: Code: Names Valpo campus. From text alone.
    9. present: Names Valpo campus. From text alone.
    10. present: Pass: Names Valpo campus. Per rubric.
    11. present: Text-only: Names Valpo campus. Per rubric (pass 11).
    12. present: Judgment: Names Valpo campus. Per rubric.
    13. present: Read: Names Valpo campus.
    14. present: Independent: Names Valpo campus.
    15. present: Note: Names Valpo campus.
    16. present: Code: Names Valpo campus. Independent.
    17. present: Names Valpo campus. Independent.
    18. present: Pass: Names Valpo campus. Independent (pass 18).
    19. present: Text-only: Names Valpo campus. From text alone.
    20. present: Judgment: Names Valpo campus. From text alone.
    21. present: Read: Names Valpo campus. From text alone.
    22. present: Independent: Names Valpo campus. Per rubric.
    23. present: Note: Names Valpo campus. Per rubric.
    24. present: Code: Names Valpo campus. Per rubric.
    25. present: Names Valpo campus (pass 25).
  • Guidancepresent25/25

    Final assessment

    Majority (25/25) mark G present.

    The protective action to take. A clear, specific instruction, such as shelter in place, evacuate, avoid the area, or run-hide-fight, drives faster and more correct protective behavior than describing the threat alone.

    See all 25 individual reads
    1. present: Orders virtual campus operations with reopen time.
    2. present: Pass: Orders virtual campus operations with reopen time.
    3. present: Text-only: Orders virtual campus operations with reopen time.
    4. present: Judgment: Orders virtual campus operations with reopen time. Independent (pass 4).
    5. present: Read: Orders virtual campus operations with reopen time. Independent.
    6. present: Independent: Orders virtual campus operations with reopen time. Independent.
    7. present: Note: Orders virtual campus operations with reopen time. From text alone.
    8. present: Code: Orders virtual campus operations with reopen time. From text alone.
    9. present: Orders virtual campus operations with reopen time. From text alone.
    10. present: Pass: Orders virtual campus operations with reopen time. Per rubric.
    11. present: Text-only: Orders virtual campus operations with reopen time. Per rubric (pass 11).
    12. present: Judgment: Orders virtual campus operations with reopen time. Per rubric.
    13. present: Read: Orders virtual campus operations with reopen time.
    14. present: Independent: Orders virtual campus operations with reopen time.
    15. present: Note: Orders virtual campus operations with reopen time.
    16. present: Code: Orders virtual campus operations with reopen time. Independent.
    17. present: Orders virtual campus operations with reopen time. Independent.
    18. present: Pass: Orders virtual campus operations with reopen time. Independent (pass 18).
    19. present: Text-only: Orders virtual campus operations with reopen time. From text alone.
    20. present: Judgment: Orders virtual campus operations with reopen time. From text alone.
    21. present: Read: Orders virtual campus operations with reopen time. From text alone.
    22. present: Independent: Orders virtual campus operations with reopen time. Per rubric.
    23. present: Note: Orders virtual campus operations with reopen time. Per rubric.
    24. present: Code: Orders virtual campus operations with reopen time. Per rubric.
    25. present: Orders virtual campus operations with reopen time (pass 25).
  • Timepresent25/25

    Final assessment

    Majority (25/25) mark T present.

    When the message applies. A timestamp, the word now or immediately, or a phrase like until further notice tells the reader whether the danger is current and how quickly to act.

    See all 25 individual reads
    1. present: Gives 1:00 PM 7/2/26 and 7/6/26 7:00 AM.
    2. present: Pass: Gives 1:00 PM 7/2/26 and 7/6/26 7:00 AM.
    3. present: Text-only: Gives 1:00 PM 7/2/26 and 7/6/26 7:00 AM.
    4. present: Judgment: Gives 1:00 PM 7/2/26 and 7/6/26 7:00 AM. Independent (pass 4).
    5. present: Read: Gives 1:00 PM 7/2/26 and 7/6/26 7:00 AM. Independent.
    6. present: Independent: Gives 1:00 PM 7/2/26 and 7/6/26 7:00 AM. Independent.
    7. present: Note: Gives 1:00 PM 7/2/26 and 7/6/26 7:00 AM. From text alone.
    8. present: Code: Gives 1:00 PM 7/2/26 and 7/6/26 7:00 AM. From text alone.
    9. present: Gives 1:00 PM 7/2/26 and 7/6/26 7:00 AM. From text alone.
    10. present: Pass: Gives 1:00 PM 7/2/26 and 7/6/26 7:00 AM. Per rubric.
    11. present: Text-only: Gives 1:00 PM 7/2/26 and 7/6/26 7:00 AM. Per rubric (pass 11).
    12. present: Judgment: Gives 1:00 PM 7/2/26 and 7/6/26 7:00 AM. Per rubric.
    13. present: Read: Gives 1:00 PM 7/2/26 and 7/6/26 7:00 AM.
    14. present: Independent: Gives 1:00 PM 7/2/26 and 7/6/26 7:00 AM.
    15. present: Note: Gives 1:00 PM 7/2/26 and 7/6/26 7:00 AM.
    16. present: Code: Gives 1:00 PM 7/2/26 and 7/6/26 7:00 AM. Independent.
    17. present: Gives 1:00 PM 7/2/26 and 7/6/26 7:00 AM. Independent.
    18. present: Pass: Gives 1:00 PM 7/2/26 and 7/6/26 7:00 AM. Independent (pass 18).
    19. present: Text-only: Gives 1:00 PM 7/2/26 and 7/6/26 7:00 AM. From text alone.
    20. present: Judgment: Gives 1:00 PM 7/2/26 and 7/6/26 7:00 AM. From text alone.
    21. present: Read: Gives 1:00 PM 7/2/26 and 7/6/26 7:00 AM. From text alone.
    22. present: Independent: Gives 1:00 PM 7/2/26 and 7/6/26 7:00 AM. Per rubric.
    23. present: Note: Gives 1:00 PM 7/2/26 and 7/6/26 7:00 AM. Per rubric.
    24. present: Code: Gives 1:00 PM 7/2/26 and 7/6/26 7:00 AM. Per rubric.
    25. present: Gives 1:00 PM 7/2/26 and 7/6/26 7:00 AM (pass 25).
  • Impactabsent1/25

    Final assessment

    Majority (1/25) mark I absent.

    What the hazard could do to the people in its path. Beyond naming the threat, a complete warning conveys its potential consequences or severity, such as that a tornado can level buildings or that a leak could be explosive, so recipients grasp how much danger they are in. Research on warning message content finds that a concrete impact statement helps people personalize their risk and act sooner.

    See all 25 individual reads
    1. absent: No severity language beyond the hazard.
    2. absent: Pass: No severity language beyond the hazard.
    3. absent: Text-only: No severity language beyond the hazard.
    4. absent: Judgment: No severity language beyond the hazard. Independent (pass 4).
    5. present: Read: Implies facility disruption. Independent.
    6. absent: Independent: No severity language beyond the hazard. Independent.
    7. absent: Note: No severity language beyond the hazard. From text alone.
    8. absent: Code: No severity language beyond the hazard. From text alone.
    9. absent: No severity language beyond the hazard. From text alone.
    10. absent: Pass: No severity language beyond the hazard. Per rubric.
    11. absent: Text-only: No severity language beyond the hazard. Per rubric (pass 11).
    12. absent: Judgment: No severity language beyond the hazard. Per rubric.
    13. absent: Read: No severity language beyond the hazard.
    14. absent: Independent: No severity language beyond the hazard.
    15. absent: Note: No severity language beyond the hazard.
    16. absent: Code: No severity language beyond the hazard. Independent.
    17. absent: No severity language beyond the hazard. Independent.
    18. absent: Pass: No severity language beyond the hazard. Independent (pass 18).
    19. absent: Text-only: No severity language beyond the hazard. From text alone.
    20. absent: Judgment: No severity language beyond the hazard. From text alone.
    21. absent: Read: No severity language beyond the hazard. From text alone.
    22. absent: Independent: No severity language beyond the hazard. Per rubric.
    23. absent: Note: No severity language beyond the hazard. Per rubric.
    24. absent: Code: No severity language beyond the hazard. Per rubric.
    25. absent: No severity language beyond the hazard (pass 25).

Coded by SuperGrok Heavy 4.5

Systematic AI judgments with visible reasoning, not human-validated codings.

About this analysis
Context

Background

Ivy Tech posts IvyAlert products on @IvyTechCC.
Analysis

Key Findings

Branded IvyAlert campus emergency or facility product.
Outcome
Virtual from 1:00 p.m. Jul 2; reopen Jul 6 7:00 a.m.
Provenance

Sources

Every claim on this page is meant to be checkable. Open the links below (and the Verify this quote control under each confirmed alert) to read the original university, news, or archive page yourself. Hostnames are shown so you can see where you are going; archived copies survive when live pages move or disappear. See also our methodology.

  1. Social
    @IvyTechCC
    x.com
    archived copy
Cite this case

Campus Alert Archive. "Ivy Tech Community College: Valpo campus multi-day virtual ops for HVAC issues." Incident of July 2, 2026. Added August 2026. https://campusalertarchive.com/case/ivy-tech-valpo-hvac-virtual-operations-2026-07-02/

Download case JSON

Alert text quoted on this page remains the work of the issuing institution; the archive is a secondary source.

Tags
community-collegeindianafacility-emergencyivy-techvalpo
Added August 2026Updated August 2026Via ingestion