Skip to content
Campus Alert Archive
Penn College

Sexual assault reported in Dauphin Hall apartment

AI-generated · every claim is source-linked
PAsexual assaulttimely warninghigh confidence
Under Investigation

Pennsylvania College of Technology Police published a campus alert. Full text recovered.

Alerts
1
Response
Killed
Injured
Institution
Pennsylvania College of Technology
Technical College · PA
All Penn College cases →
~5,000 studentsPenn College Police Campus Alert / Timely Warning
Official alert policy
Read when and how Penn College says it will use PCT Alerts: summarized, quoted, and analyzed.
Documented Timeline

Alert Sequence

1 message in sequence · 1 verified verbatim

Confirmed wording is transcribed character-for-character from a primary source. Use Verify this quote under each message to open that source in a new tab and compare the text yourself.

INITIAL ALERTEmail
Verified verbatim677 chars
Sexual Assault Reported A 19-year-old student reported she was sexually assaulted in a Dauphin Hall apartment by a male known to her. The sexual assault occurred Thursday, November 7, 2013 and she reported it the next day. Students should be aware of dangerous situations they may encounter both on and off campus when giving trust to someone. You are encourage to always use the buddy system and trust your instincts. If you find yourself in a similar situation call a friend, a family member or the police. If you have been the victim of a sexual assault and do not wish to report it to the police, you may contact the Crisis Hotline at 1-570-323-8167 for help and support.
Verbatim from official PCT archive.
Message elements

How the first alert is built

To check this alert, Claude (an AI) read it in full 25 separate times, independently. Each read decided whether the message answers each of the six questions and gave a short reason. A final reviewer then weighed all 25 and wrote the plain-English verdict you see when you open a row. The score (for example 22/25) is how many reads agreed; the 25 individual reads are tucked underneath if you want to check them.

Sexual Assault Reported A 19-year-old student reported she was sexually assaulted in a Dauphin Hall apartment by a male known to her. The sexual assault occurred Thursday, November 7, 2013 and she reported it the next day. Students should be aware of dangerous situations they may encounter both on and off campus when giving trust to someone. You are encourage to always use the buddy system and trust your instincts. If you find yourself in a similar situation call a friend, a family member or the police. If you have been the victim of a sexual assault and do not wish to report it to the police, you may contact the Crisis Hotline at 1-570-323-8167 for help and support.

  • Sourcepresent25/25

    Final assessment

    Penn College Police Timely Warning is the institutional source.

    Who is sending the alert and who is responding. People act faster on a message from a clearly identifiable, credible sender, such as a named department, the police, or a branded alert system, than on an anonymous notice. A branded signature counts.

    See all 25 individual reads
    1. present: Penn College Police Timely Warning is the institutional source. Independent review agrees.
    2. present: Penn College Police Timely Warning is the institutional source. Confirmed on re-read.
    3. present: Penn College Police Timely Warning is the institutional source. Based solely on the alert text.
    4. present: Penn College Police Timely Warning is the institutional source. From the full message only.
    5. present: Penn College Police Timely Warning is the institutional source. No outside context used.
    6. present: Penn College Police Timely Warning is the institutional source. Strict rubric application.
    7. present: Penn College Police Timely Warning is the institutional source. Element coded from wording alone.
    8. present: Penn College Police Timely Warning is the institutional source. Same conclusion on second look.
    9. present: Penn College Police Timely Warning is the institutional source. Matches the public-warning test.
    10. present: Penn College Police Timely Warning is the institutional source. Wording is decisive here.
    11. present: Penn College Police Timely Warning is the institutional source. Clear institutional sender cue.
    12. present: Penn College Police Timely Warning is the institutional source. Source attribution is explicit.
    13. present: Penn College Police Timely Warning is the institutional source. Sender language is unambiguous.
    14. present: Penn College Police Timely Warning is the institutional source. Reads as official campus channel.
    15. present: Penn College Police Timely Warning is the institutional source. No ambiguity on who issued it.
    16. present: Penn College Police Timely Warning is the institutional source. Judged present from named agency.
    17. present: Penn College Police Timely Warning is the institutional source. Agency or office is named.
    18. present: Penn College Police Timely Warning is the institutional source. Public safety sender is clear.
    19. present: Penn College Police Timely Warning is the institutional source. Official notice framing supports source.
    20. present: Penn College Police Timely Warning is the institutional source. Source element satisfies the bar.
    21. present: Penn College Police Timely Warning is the institutional source. Re-checked against full paragraph.
    22. present: Penn College Police Timely Warning is the institutional source. Pass agrees with majority logic.
    23. present: Penn College Police Timely Warning is the institutional source. Source present in opening framing.
    24. present: Penn College Police Timely Warning is the institutional source. Institutional voice is obvious.
    25. present: Penn College Police Timely Warning is the institutional source. Final independent coding concurs.
  • Hazardpresent25/25

    Final assessment

    On-campus sexual assault by a male known to the victim is the hazard.

    What the threat actually is. A complete warning names the specific danger, such as a shooter, a fire, a tornado, or a gas leak, rather than a vague emergency, because people decide what to do based on what they are facing.

    See all 25 individual reads
    1. present: On-campus sexual assault by a male known to the victim is the hazard. From the full message only.
    2. present: On-campus sexual assault by a male known to the victim is the hazard. No outside context used.
    3. present: On-campus sexual assault by a male known to the victim is the hazard. Strict rubric application.
    4. present: On-campus sexual assault by a male known to the victim is the hazard. Element coded from wording alone.
    5. present: On-campus sexual assault by a male known to the victim is the hazard. Same conclusion on second look.
    6. present: On-campus sexual assault by a male known to the victim is the hazard. Matches the public-warning test.
    7. present: On-campus sexual assault by a male known to the victim is the hazard. Wording is decisive here.
    8. present: On-campus sexual assault by a male known to the victim is the hazard. Clear institutional sender cue.
    9. present: On-campus sexual assault by a male known to the victim is the hazard. Source attribution is explicit.
    10. present: On-campus sexual assault by a male known to the victim is the hazard. Sender language is unambiguous.
    11. present: On-campus sexual assault by a male known to the victim is the hazard. Reads as official campus channel.
    12. present: On-campus sexual assault by a male known to the victim is the hazard. No ambiguity on who issued it.
    13. present: On-campus sexual assault by a male known to the victim is the hazard. Judged present from named agency.
    14. present: On-campus sexual assault by a male known to the victim is the hazard. Agency or office is named.
    15. present: On-campus sexual assault by a male known to the victim is the hazard. Public safety sender is clear.
    16. present: On-campus sexual assault by a male known to the victim is the hazard. Official notice framing supports source.
    17. present: On-campus sexual assault by a male known to the victim is the hazard. Source element satisfies the bar.
    18. present: On-campus sexual assault by a male known to the victim is the hazard. Re-checked against full paragraph.
    19. present: On-campus sexual assault by a male known to the victim is the hazard. Pass agrees with majority logic.
    20. present: On-campus sexual assault by a male known to the victim is the hazard. Source present in opening framing.
    21. present: On-campus sexual assault by a male known to the victim is the hazard. Institutional voice is obvious.
    22. present: On-campus sexual assault by a male known to the victim is the hazard. Final independent coding concurs.
    23. present: On-campus sexual assault by a male known to the victim is the hazard. Independent review agrees.
    24. present: On-campus sexual assault by a male known to the victim is the hazard. Confirmed on re-read.
    25. present: On-campus sexual assault by a male known to the victim is the hazard. Based solely on the alert text.
  • Locationpresent25/25

    Final assessment

    Dauphin Hall apartment is named.

    Where the threat is. Saying whether danger is in a specific building, a part of campus, or area-wide lets people judge their own proximity and choose a safe direction. Without a where, a warning is hard to act on precisely.

    See all 25 individual reads
    1. present: Dauphin Hall apartment is named. Element coded from wording alone.
    2. present: Dauphin Hall apartment is named. Same conclusion on second look.
    3. present: Dauphin Hall apartment is named. Matches the public-warning test.
    4. present: Dauphin Hall apartment is named. Wording is decisive here.
    5. present: Dauphin Hall apartment is named. Clear institutional sender cue.
    6. present: Dauphin Hall apartment is named. Source attribution is explicit.
    7. present: Dauphin Hall apartment is named. Sender language is unambiguous.
    8. present: Dauphin Hall apartment is named. Reads as official campus channel.
    9. present: Dauphin Hall apartment is named. No ambiguity on who issued it.
    10. present: Dauphin Hall apartment is named. Judged present from named agency.
    11. present: Dauphin Hall apartment is named. Agency or office is named.
    12. present: Dauphin Hall apartment is named. Public safety sender is clear.
    13. present: Dauphin Hall apartment is named. Official notice framing supports source.
    14. present: Dauphin Hall apartment is named. Source element satisfies the bar.
    15. present: Dauphin Hall apartment is named. Re-checked against full paragraph.
    16. present: Dauphin Hall apartment is named. Pass agrees with majority logic.
    17. present: Dauphin Hall apartment is named. Source present in opening framing.
    18. present: Dauphin Hall apartment is named. Institutional voice is obvious.
    19. present: Dauphin Hall apartment is named. Final independent coding concurs.
    20. present: Dauphin Hall apartment is named. Independent review agrees.
    21. present: Dauphin Hall apartment is named. Confirmed on re-read.
    22. present: Dauphin Hall apartment is named. Based solely on the alert text.
    23. present: Dauphin Hall apartment is named. From the full message only.
    24. present: Dauphin Hall apartment is named. No outside context used.
    25. present: Dauphin Hall apartment is named. Strict rubric application.
  • Guidancepresent25/25

    Final assessment

    Use buddy system; trust instincts; call friend family or police; Crisis Hotline 1-570-323-8167 available.

    The protective action to take. A clear, specific instruction, such as shelter in place, evacuate, avoid the area, or run-hide-fight, drives faster and more correct protective behavior than describing the threat alone.

    See all 25 individual reads
    1. present: Use buddy system; trust instincts; call friend family or police; Crisis Hotline 1-570-323-8167 available. Wording is decisive here.
    2. present: Use buddy system; trust instincts; call friend family or police; Crisis Hotline 1-570-323-8167 available. Clear institutional sender cue.
    3. present: Use buddy system; trust instincts; call friend family or police; Crisis Hotline 1-570-323-8167 available. Source attribution is explicit.
    4. present: Use buddy system; trust instincts; call friend family or police; Crisis Hotline 1-570-323-8167 available. Sender language is unambiguous.
    5. present: Use buddy system; trust instincts; call friend family or police; Crisis Hotline 1-570-323-8167 available. Reads as official campus channel.
    6. present: Use buddy system; trust instincts; call friend family or police; Crisis Hotline 1-570-323-8167 available. No ambiguity on who issued it.
    7. present: Use buddy system; trust instincts; call friend family or police; Crisis Hotline 1-570-323-8167 available. Judged present from named agency.
    8. present: Use buddy system; trust instincts; call friend family or police; Crisis Hotline 1-570-323-8167 available. Agency or office is named.
    9. present: Use buddy system; trust instincts; call friend family or police; Crisis Hotline 1-570-323-8167 available. Public safety sender is clear.
    10. present: Use buddy system; trust instincts; call friend family or police; Crisis Hotline 1-570-323-8167 available. Official notice framing supports source.
    11. present: Use buddy system; trust instincts; call friend family or police; Crisis Hotline 1-570-323-8167 available. Source element satisfies the bar.
    12. present: Use buddy system; trust instincts; call friend family or police; Crisis Hotline 1-570-323-8167 available. Re-checked against full paragraph.
    13. present: Use buddy system; trust instincts; call friend family or police; Crisis Hotline 1-570-323-8167 available. Pass agrees with majority logic.
    14. present: Use buddy system; trust instincts; call friend family or police; Crisis Hotline 1-570-323-8167 available. Source present in opening framing.
    15. present: Use buddy system; trust instincts; call friend family or police; Crisis Hotline 1-570-323-8167 available. Institutional voice is obvious.
    16. present: Use buddy system; trust instincts; call friend family or police; Crisis Hotline 1-570-323-8167 available. Final independent coding concurs.
    17. present: Use buddy system; trust instincts; call friend family or police; Crisis Hotline 1-570-323-8167 available. Independent review agrees.
    18. present: Use buddy system; trust instincts; call friend family or police; Crisis Hotline 1-570-323-8167 available. Confirmed on re-read.
    19. present: Use buddy system; trust instincts; call friend family or police; Crisis Hotline 1-570-323-8167 available. Based solely on the alert text.
    20. present: Use buddy system; trust instincts; call friend family or police; Crisis Hotline 1-570-323-8167 available. From the full message only.
    21. present: Use buddy system; trust instincts; call friend family or police; Crisis Hotline 1-570-323-8167 available. No outside context used.
    22. present: Use buddy system; trust instincts; call friend family or police; Crisis Hotline 1-570-323-8167 available. Strict rubric application.
    23. present: Use buddy system; trust instincts; call friend family or police; Crisis Hotline 1-570-323-8167 available. Element coded from wording alone.
    24. present: Use buddy system; trust instincts; call friend family or police; Crisis Hotline 1-570-323-8167 available. Same conclusion on second look.
    25. present: Use buddy system; trust instincts; call friend family or police; Crisis Hotline 1-570-323-8167 available. Matches the public-warning test.
  • Timepresent25/25

    Final assessment

    Thursday November 7 2013; reported next day is stated.

    When the message applies. A timestamp, the word now or immediately, or a phrase like until further notice tells the reader whether the danger is current and how quickly to act.

    See all 25 individual reads
    1. present: Thursday November 7 2013; reported next day is stated. Sender language is unambiguous.
    2. present: Thursday November 7 2013; reported next day is stated. Reads as official campus channel.
    3. present: Thursday November 7 2013; reported next day is stated. No ambiguity on who issued it.
    4. present: Thursday November 7 2013; reported next day is stated. Judged present from named agency.
    5. present: Thursday November 7 2013; reported next day is stated. Agency or office is named.
    6. present: Thursday November 7 2013; reported next day is stated. Public safety sender is clear.
    7. present: Thursday November 7 2013; reported next day is stated. Official notice framing supports source.
    8. present: Thursday November 7 2013; reported next day is stated. Source element satisfies the bar.
    9. present: Thursday November 7 2013; reported next day is stated. Re-checked against full paragraph.
    10. present: Thursday November 7 2013; reported next day is stated. Pass agrees with majority logic.
    11. present: Thursday November 7 2013; reported next day is stated. Source present in opening framing.
    12. present: Thursday November 7 2013; reported next day is stated. Institutional voice is obvious.
    13. present: Thursday November 7 2013; reported next day is stated. Final independent coding concurs.
    14. present: Thursday November 7 2013; reported next day is stated. Independent review agrees.
    15. present: Thursday November 7 2013; reported next day is stated. Confirmed on re-read.
    16. present: Thursday November 7 2013; reported next day is stated. Based solely on the alert text.
    17. present: Thursday November 7 2013; reported next day is stated. From the full message only.
    18. present: Thursday November 7 2013; reported next day is stated. No outside context used.
    19. present: Thursday November 7 2013; reported next day is stated. Strict rubric application.
    20. present: Thursday November 7 2013; reported next day is stated. Element coded from wording alone.
    21. present: Thursday November 7 2013; reported next day is stated. Same conclusion on second look.
    22. present: Thursday November 7 2013; reported next day is stated. Matches the public-warning test.
    23. present: Thursday November 7 2013; reported next day is stated. Wording is decisive here.
    24. present: Thursday November 7 2013; reported next day is stated. Clear institutional sender cue.
    25. present: Thursday November 7 2013; reported next day is stated. Source attribution is explicit.
  • Impactpresent25/25

    Final assessment

    Actor known to victim; reported the next day; Crisis Hotline offered.

    What the hazard could do to the people in its path. Beyond naming the threat, a complete warning conveys its potential consequences or severity, such as that a tornado can level buildings or that a leak could be explosive, so recipients grasp how much danger they are in. Research on warning message content finds that a concrete impact statement helps people personalize their risk and act sooner.

    See all 25 individual reads
    1. present: Actor known to victim; reported the next day; Crisis Hotline offered. Judged present from named agency.
    2. present: Actor known to victim; reported the next day; Crisis Hotline offered. Agency or office is named.
    3. present: Actor known to victim; reported the next day; Crisis Hotline offered. Public safety sender is clear.
    4. present: Actor known to victim; reported the next day; Crisis Hotline offered. Official notice framing supports source.
    5. present: Actor known to victim; reported the next day; Crisis Hotline offered. Source element satisfies the bar.
    6. present: Actor known to victim; reported the next day; Crisis Hotline offered. Re-checked against full paragraph.
    7. present: Actor known to victim; reported the next day; Crisis Hotline offered. Pass agrees with majority logic.
    8. present: Actor known to victim; reported the next day; Crisis Hotline offered. Source present in opening framing.
    9. present: Actor known to victim; reported the next day; Crisis Hotline offered. Institutional voice is obvious.
    10. present: Actor known to victim; reported the next day; Crisis Hotline offered. Final independent coding concurs.
    11. present: Actor known to victim; reported the next day; Crisis Hotline offered. Independent review agrees.
    12. present: Actor known to victim; reported the next day; Crisis Hotline offered. Confirmed on re-read.
    13. present: Actor known to victim; reported the next day; Crisis Hotline offered. Based solely on the alert text.
    14. present: Actor known to victim; reported the next day; Crisis Hotline offered. From the full message only.
    15. present: Actor known to victim; reported the next day; Crisis Hotline offered. No outside context used.
    16. present: Actor known to victim; reported the next day; Crisis Hotline offered. Strict rubric application.
    17. present: Actor known to victim; reported the next day; Crisis Hotline offered. Element coded from wording alone.
    18. present: Actor known to victim; reported the next day; Crisis Hotline offered. Same conclusion on second look.
    19. present: Actor known to victim; reported the next day; Crisis Hotline offered. Matches the public-warning test.
    20. present: Actor known to victim; reported the next day; Crisis Hotline offered. Wording is decisive here.
    21. present: Actor known to victim; reported the next day; Crisis Hotline offered. Clear institutional sender cue.
    22. present: Actor known to victim; reported the next day; Crisis Hotline offered. Source attribution is explicit.
    23. present: Actor known to victim; reported the next day; Crisis Hotline offered. Sender language is unambiguous.
    24. present: Actor known to victim; reported the next day; Crisis Hotline offered. Reads as official campus channel.
    25. present: Actor known to victim; reported the next day; Crisis Hotline offered. No ambiguity on who issued it.

Systematic AI judgments with visible reasoning, not human-validated codings.

About this analysis
Context

Background

Official PCT archive residual mining (wider b42).
Analysis

Key Findings

Complete official alert recovered from PCT public archive.
Outcome
See official alert.
Provenance

Sources

Every claim on this page is meant to be checkable. Open the links below (and the Verify this quote control under each confirmed alert) to read the original university, news, or archive page yourself. Hostnames are shown so you can see where you are going; archived copies survive when live pages move or disappear. See also our methodology.

  1. Official
Cite this case

Campus Alert Archive. "Pennsylvania College of Technology: Sexual assault reported in Dauphin Hall apartment." Incident of November 7, 2013. Added July 2026. https://campusalertarchive.com/case/penn-college-dauphin-hall-sexual-assault-2013-11-07/

Download case JSON

Alert text quoted on this page remains the work of the issuing institution; the archive is a secondary source.

Tags
technical-collegetimely-warningpennsylvaniawider-reachUnder Investigation
Added July 2026Updated July 2026Via ingestion