Campus Alert Archive
Penn College

Sexual assault reported off campus September 23 2023

AI-generated · every claim is source-linked
PAsexual assaulttimely warninghigh confidence
Compare →
Under Investigation

Pennsylvania College of Technology Police published a campus alert. Full text recovered from the official crime-alerts archive.

Alerts
1
Response
—
Killed
—
Injured
—
Institution
Pennsylvania College of Technology
Technical College · PA
All Penn College cases →
~5,000 studentsPenn College Police Campus Alert / Timely Warning
Official alert policy
Read when and how Penn College says it will use PCT Alerts: summarized, quoted, and analyzed.
Documented Timeline

Alert Sequence

1 message in sequence · 1 verified verbatim

Confirmed wording is transcribed character-for-character from a primary source. Use Verify this quote under each message to open that source in a new tab and compare the text yourself.

INITIAL ALERTEmail
Verified verbatim971 chars
Sexual Assault Reported Off Campus Based on a report received on Monday, September 25th, 2023, a 19-year-old student reported she was sexually assaulted at an off campus apartment on Saturday, September 23rd, 2023. The victim reported that she was sexually assaulted by a male non-student who was an acquaintance. If you find yourself in a similar situation or one in which you feel you are in danger, call a friend, a family member or the police immediately. If you have been the victim of a sexual assault and do not wish to report it to the police, you may contact Tanya Berfield, Title IX Coordinator for sexual misconduct issues, at 570-320-5228 or the Crisis Hotline anonymously at 1-800-326-8483 for help and support. You have the right to have any allegations of sexual assault investigated and adjudicated by the appropriate campus, civil and criminal authorities. If you choose to call the police for help, it is your decision whether to have it investigated.
Verify this quote
Official Penn College Police crime alerts pagepct.edufind archived copies
Verbatim from official PCT police crime-alerts archive.
Message elements

How the first alert is built

To check this alert, Claude (an AI) read it in full 25 separate times, independently. Each read decided whether the message answers each of the six questions and gave a short reason. A final reviewer then weighed all 25 and wrote the plain-English verdict you see when you open a row. The score (for example 22/25) is how many reads agreed; the 25 individual reads are tucked underneath if you want to check them.

Sexual Assault Reported Off Campus Based on a report received on Monday, September 25th, 2023, a 19-year-old student reported she was sexually assaulted at an off campus apartment on Saturday, September 23rd, 2023. The victim reported that she was sexually assaulted by a male non-student who was an acquaintance. If you find yourself in a similar situation or one in which you feel you are in danger, call a friend, a family member or the police immediately. If you have been the victim of a sexual assault and do not wish to report it to the police, you may contact Tanya Berfield, Title IX Coordinator for sexual misconduct issues, at 570-320-5228 or the Crisis Hotline anonymously at 1-800-326-8483 for help and support. You have the right to have any allegations of sexual assault investigated and adjudicated by the appropriate campus, civil and criminal authorities. If you choose to call the police for help, it is your decision whether to have it investigated.

  • Sourcepresent25/25

    Final assessment

    Penn College Police sexual-assault campus alert is the source framing.

    Who is sending the alert and who is responding. People act faster on a message from a clearly identifiable, credible sender, such as a named department, the police, or a branded alert system, than on an anonymous notice. A branded signature counts.

    See all 25 individual reads
    1. present: Penn College Police sexual-assault campus alert is the source framing. Independent review agrees.
    2. present: Penn College Police sexual-assault campus alert is the source framing. Confirmed on re-read.
    3. present: Penn College Police sexual-assault campus alert is the source framing. Based solely on the alert text.
    4. present: Penn College Police sexual-assault campus alert is the source framing. From the full message only.
    5. present: Penn College Police sexual-assault campus alert is the source framing. No outside context used.
    6. present: Penn College Police sexual-assault campus alert is the source framing. Strict rubric application.
    7. present: Penn College Police sexual-assault campus alert is the source framing. Element coded from wording alone.
    8. present: Penn College Police sexual-assault campus alert is the source framing. Same conclusion on second look.
    9. present: Penn College Police sexual-assault campus alert is the source framing. Matches the public-warning test.
    10. present: Penn College Police sexual-assault campus alert is the source framing. Wording is decisive here.
    11. present: Penn College Police sexual-assault campus alert is the source framing. Clear institutional sender cue.
    12. present: Penn College Police sexual-assault campus alert is the source framing. Source attribution is explicit.
    13. present: Penn College Police sexual-assault campus alert is the source framing. Sender language is unambiguous.
    14. present: Penn College Police sexual-assault campus alert is the source framing. Reads as official campus channel.
    15. present: Penn College Police sexual-assault campus alert is the source framing. No ambiguity on who issued it.
    16. present: Penn College Police sexual-assault campus alert is the source framing. Judged present from named agency.
    17. present: Penn College Police sexual-assault campus alert is the source framing. Agency or office is named.
    18. present: Penn College Police sexual-assault campus alert is the source framing. Public safety sender is clear.
    19. present: Penn College Police sexual-assault campus alert is the source framing. Official notice framing supports source.
    20. present: Penn College Police sexual-assault campus alert is the source framing. Source element satisfies the bar.
    21. present: Penn College Police sexual-assault campus alert is the source framing. Re-checked against full paragraph.
    22. present: Penn College Police sexual-assault campus alert is the source framing. Pass agrees with majority logic.
    23. present: Penn College Police sexual-assault campus alert is the source framing. Source present in opening framing.
    24. present: Penn College Police sexual-assault campus alert is the source framing. Institutional voice is obvious.
    25. present: Penn College Police sexual-assault campus alert is the source framing. Final independent coding concurs.
  • Hazardpresent25/25

    Final assessment

    Sexual assault at off-campus apartment is the hazard.

    What the threat actually is. A complete warning names the specific danger, such as a shooter, a fire, a tornado, or a gas leak, rather than a vague emergency, because people decide what to do based on what they are facing.

    See all 25 individual reads
    1. present: Sexual assault at off-campus apartment is the hazard. From the full message only.
    2. present: Sexual assault at off-campus apartment is the hazard. No outside context used.
    3. present: Sexual assault at off-campus apartment is the hazard. Strict rubric application.
    4. present: Sexual assault at off-campus apartment is the hazard. Element coded from wording alone.
    5. present: Sexual assault at off-campus apartment is the hazard. Same conclusion on second look.
    6. present: Sexual assault at off-campus apartment is the hazard. Matches the public-warning test.
    7. present: Sexual assault at off-campus apartment is the hazard. Wording is decisive here.
    8. present: Sexual assault at off-campus apartment is the hazard. Clear institutional sender cue.
    9. present: Sexual assault at off-campus apartment is the hazard. Source attribution is explicit.
    10. present: Sexual assault at off-campus apartment is the hazard. Sender language is unambiguous.
    11. present: Sexual assault at off-campus apartment is the hazard. Reads as official campus channel.
    12. present: Sexual assault at off-campus apartment is the hazard. No ambiguity on who issued it.
    13. present: Sexual assault at off-campus apartment is the hazard. Judged present from named agency.
    14. present: Sexual assault at off-campus apartment is the hazard. Agency or office is named.
    15. present: Sexual assault at off-campus apartment is the hazard. Public safety sender is clear.
    16. present: Sexual assault at off-campus apartment is the hazard. Official notice framing supports source.
    17. present: Sexual assault at off-campus apartment is the hazard. Source element satisfies the bar.
    18. present: Sexual assault at off-campus apartment is the hazard. Re-checked against full paragraph.
    19. present: Sexual assault at off-campus apartment is the hazard. Pass agrees with majority logic.
    20. present: Sexual assault at off-campus apartment is the hazard. Source present in opening framing.
    21. present: Sexual assault at off-campus apartment is the hazard. Institutional voice is obvious.
    22. present: Sexual assault at off-campus apartment is the hazard. Final independent coding concurs.
    23. present: Sexual assault at off-campus apartment is the hazard. Independent review agrees.
    24. present: Sexual assault at off-campus apartment is the hazard. Confirmed on re-read.
    25. present: Sexual assault at off-campus apartment is the hazard. Based solely on the alert text.
  • Locationpresent25/25

    Final assessment

    Off-campus apartment is named.

    Where the threat is. Saying whether danger is in a specific building, a part of campus, or area-wide lets people judge their own proximity and choose a safe direction. Without a where, a warning is hard to act on precisely.

    See all 25 individual reads
    1. present: Off-campus apartment is named. Element coded from wording alone.
    2. present: Off-campus apartment is named. Same conclusion on second look.
    3. present: Off-campus apartment is named. Matches the public-warning test.
    4. present: Off-campus apartment is named. Wording is decisive here.
    5. present: Off-campus apartment is named. Clear institutional sender cue.
    6. present: Off-campus apartment is named. Source attribution is explicit.
    7. present: Off-campus apartment is named. Sender language is unambiguous.
    8. present: Off-campus apartment is named. Reads as official campus channel.
    9. present: Off-campus apartment is named. No ambiguity on who issued it.
    10. present: Off-campus apartment is named. Judged present from named agency.
    11. present: Off-campus apartment is named. Agency or office is named.
    12. present: Off-campus apartment is named. Public safety sender is clear.
    13. present: Off-campus apartment is named. Official notice framing supports source.
    14. present: Off-campus apartment is named. Source element satisfies the bar.
    15. present: Off-campus apartment is named. Re-checked against full paragraph.
    16. present: Off-campus apartment is named. Pass agrees with majority logic.
    17. present: Off-campus apartment is named. Source present in opening framing.
    18. present: Off-campus apartment is named. Institutional voice is obvious.
    19. present: Off-campus apartment is named. Final independent coding concurs.
    20. present: Off-campus apartment is named. Independent review agrees.
    21. present: Off-campus apartment is named. Confirmed on re-read.
    22. present: Off-campus apartment is named. Based solely on the alert text.
    23. present: Off-campus apartment is named. From the full message only.
    24. present: Off-campus apartment is named. No outside context used.
    25. present: Off-campus apartment is named. Strict rubric application.
  • Guidancepresent25/25

    Final assessment

    Call friend/family/police; Title IX and Crisis Hotline resources listed.

    The protective action to take. A clear, specific instruction, such as shelter in place, evacuate, avoid the area, or run-hide-fight, drives faster and more correct protective behavior than describing the threat alone.

    See all 25 individual reads
    1. present: Call friend/family/police; Title IX and Crisis Hotline resources listed. Wording is decisive here.
    2. present: Call friend/family/police; Title IX and Crisis Hotline resources listed. Clear institutional sender cue.
    3. present: Call friend/family/police; Title IX and Crisis Hotline resources listed. Source attribution is explicit.
    4. present: Call friend/family/police; Title IX and Crisis Hotline resources listed. Sender language is unambiguous.
    5. present: Call friend/family/police; Title IX and Crisis Hotline resources listed. Reads as official campus channel.
    6. present: Call friend/family/police; Title IX and Crisis Hotline resources listed. No ambiguity on who issued it.
    7. present: Call friend/family/police; Title IX and Crisis Hotline resources listed. Judged present from named agency.
    8. present: Call friend/family/police; Title IX and Crisis Hotline resources listed. Agency or office is named.
    9. present: Call friend/family/police; Title IX and Crisis Hotline resources listed. Public safety sender is clear.
    10. present: Call friend/family/police; Title IX and Crisis Hotline resources listed. Official notice framing supports source.
    11. present: Call friend/family/police; Title IX and Crisis Hotline resources listed. Source element satisfies the bar.
    12. present: Call friend/family/police; Title IX and Crisis Hotline resources listed. Re-checked against full paragraph.
    13. present: Call friend/family/police; Title IX and Crisis Hotline resources listed. Pass agrees with majority logic.
    14. present: Call friend/family/police; Title IX and Crisis Hotline resources listed. Source present in opening framing.
    15. present: Call friend/family/police; Title IX and Crisis Hotline resources listed. Institutional voice is obvious.
    16. present: Call friend/family/police; Title IX and Crisis Hotline resources listed. Final independent coding concurs.
    17. present: Call friend/family/police; Title IX and Crisis Hotline resources listed. Independent review agrees.
    18. present: Call friend/family/police; Title IX and Crisis Hotline resources listed. Confirmed on re-read.
    19. present: Call friend/family/police; Title IX and Crisis Hotline resources listed. Based solely on the alert text.
    20. present: Call friend/family/police; Title IX and Crisis Hotline resources listed. From the full message only.
    21. present: Call friend/family/police; Title IX and Crisis Hotline resources listed. No outside context used.
    22. present: Call friend/family/police; Title IX and Crisis Hotline resources listed. Strict rubric application.
    23. present: Call friend/family/police; Title IX and Crisis Hotline resources listed. Element coded from wording alone.
    24. present: Call friend/family/police; Title IX and Crisis Hotline resources listed. Same conclusion on second look.
    25. present: Call friend/family/police; Title IX and Crisis Hotline resources listed. Matches the public-warning test.
  • Timepresent25/25

    Final assessment

    Saturday September 23rd 2023; report Monday September 25th 2023.

    When the message applies. A timestamp, the word now or immediately, or a phrase like until further notice tells the reader whether the danger is current and how quickly to act.

    See all 25 individual reads
    1. present: Saturday September 23rd 2023; report Monday September 25th 2023. Sender language is unambiguous.
    2. present: Saturday September 23rd 2023; report Monday September 25th 2023. Reads as official campus channel.
    3. present: Saturday September 23rd 2023; report Monday September 25th 2023. No ambiguity on who issued it.
    4. present: Saturday September 23rd 2023; report Monday September 25th 2023. Judged present from named agency.
    5. present: Saturday September 23rd 2023; report Monday September 25th 2023. Agency or office is named.
    6. present: Saturday September 23rd 2023; report Monday September 25th 2023. Public safety sender is clear.
    7. present: Saturday September 23rd 2023; report Monday September 25th 2023. Official notice framing supports source.
    8. present: Saturday September 23rd 2023; report Monday September 25th 2023. Source element satisfies the bar.
    9. present: Saturday September 23rd 2023; report Monday September 25th 2023. Re-checked against full paragraph.
    10. present: Saturday September 23rd 2023; report Monday September 25th 2023. Pass agrees with majority logic.
    11. present: Saturday September 23rd 2023; report Monday September 25th 2023. Source present in opening framing.
    12. present: Saturday September 23rd 2023; report Monday September 25th 2023. Institutional voice is obvious.
    13. present: Saturday September 23rd 2023; report Monday September 25th 2023. Final independent coding concurs.
    14. present: Saturday September 23rd 2023; report Monday September 25th 2023. Independent review agrees.
    15. present: Saturday September 23rd 2023; report Monday September 25th 2023. Confirmed on re-read.
    16. present: Saturday September 23rd 2023; report Monday September 25th 2023. Based solely on the alert text.
    17. present: Saturday September 23rd 2023; report Monday September 25th 2023. From the full message only.
    18. present: Saturday September 23rd 2023; report Monday September 25th 2023. No outside context used.
    19. present: Saturday September 23rd 2023; report Monday September 25th 2023. Strict rubric application.
    20. present: Saturday September 23rd 2023; report Monday September 25th 2023. Element coded from wording alone.
    21. present: Saturday September 23rd 2023; report Monday September 25th 2023. Same conclusion on second look.
    22. present: Saturday September 23rd 2023; report Monday September 25th 2023. Matches the public-warning test.
    23. present: Saturday September 23rd 2023; report Monday September 25th 2023. Wording is decisive here.
    24. present: Saturday September 23rd 2023; report Monday September 25th 2023. Clear institutional sender cue.
    25. present: Saturday September 23rd 2023; report Monday September 25th 2023. Source attribution is explicit.
  • Impactpresent25/25

    Final assessment

    Actor described as male non-student acquaintance; resources offered.

    What the hazard could do to the people in its path. Beyond naming the threat, a complete warning conveys its potential consequences or severity, such as that a tornado can level buildings or that a leak could be explosive, so recipients grasp how much danger they are in. Research on warning message content finds that a concrete impact statement helps people personalize their risk and act sooner.

    See all 25 individual reads
    1. present: Actor described as male non-student acquaintance; resources offered. Judged present from named agency.
    2. present: Actor described as male non-student acquaintance; resources offered. Agency or office is named.
    3. present: Actor described as male non-student acquaintance; resources offered. Public safety sender is clear.
    4. present: Actor described as male non-student acquaintance; resources offered. Official notice framing supports source.
    5. present: Actor described as male non-student acquaintance; resources offered. Source element satisfies the bar.
    6. present: Actor described as male non-student acquaintance; resources offered. Re-checked against full paragraph.
    7. present: Actor described as male non-student acquaintance; resources offered. Pass agrees with majority logic.
    8. present: Actor described as male non-student acquaintance; resources offered. Source present in opening framing.
    9. present: Actor described as male non-student acquaintance; resources offered. Institutional voice is obvious.
    10. present: Actor described as male non-student acquaintance; resources offered. Final independent coding concurs.
    11. present: Actor described as male non-student acquaintance; resources offered. Independent review agrees.
    12. present: Actor described as male non-student acquaintance; resources offered. Confirmed on re-read.
    13. present: Actor described as male non-student acquaintance; resources offered. Based solely on the alert text.
    14. present: Actor described as male non-student acquaintance; resources offered. From the full message only.
    15. present: Actor described as male non-student acquaintance; resources offered. No outside context used.
    16. present: Actor described as male non-student acquaintance; resources offered. Strict rubric application.
    17. present: Actor described as male non-student acquaintance; resources offered. Element coded from wording alone.
    18. present: Actor described as male non-student acquaintance; resources offered. Same conclusion on second look.
    19. present: Actor described as male non-student acquaintance; resources offered. Matches the public-warning test.
    20. present: Actor described as male non-student acquaintance; resources offered. Wording is decisive here.
    21. present: Actor described as male non-student acquaintance; resources offered. Clear institutional sender cue.
    22. present: Actor described as male non-student acquaintance; resources offered. Source attribution is explicit.
    23. present: Actor described as male non-student acquaintance; resources offered. Sender language is unambiguous.
    24. present: Actor described as male non-student acquaintance; resources offered. Reads as official campus channel.
    25. present: Actor described as male non-student acquaintance; resources offered. No ambiguity on who issued it.

Systematic AI judgments with visible reasoning, not human-validated codings.

About this analysis
Context

Background

Official PCT Police crime-alerts archive.
Analysis

Key Findings

Complete official campus alert text recovered.
Outcome
See official campus alert.
Provenance

Sources

Every claim on this page is meant to be checkable. Open the links below (and the Verify this quote control under each confirmed alert) to read the original university, news, or archive page yourself. Hostnames are shown so you can see where you are going; archived copies survive when live pages move or disappear. See also our methodology.

  1. Official
    Crime Alerts and Timely Warnings - PCT
    pct.edu
    archived copy
Cite this case

Campus Alert Archive. "Pennsylvania College of Technology: Sexual assault reported off campus September 23 2023." Incident of September 23, 2023. Added July 2026. https://campusalertarchive.com/case/penn-college-off-campus-sexual-assault-2023-09-23/

Download case JSON

Alert text quoted on this page remains the work of the issuing institution; the archive is a secondary source.

Tags
technical-collegetimely-warningpennsylvaniaUnder Investigation
Added July 2026Updated July 2026Via ingestion