Campus Alert Archive
Penn College

Sexual assault reported in Rose Street Commons apartment

AI-generated · every claim is source-linked
PAsexual assaulttimely warninghigh confidence
Compare →
Under Investigation

Pennsylvania College of Technology Police published a campus alert. Full text recovered.

Alerts
1
Response
—
Killed
—
Injured
—
Institution
Pennsylvania College of Technology
Technical College · PA
All Penn College cases →
~5,000 studentsPenn College Police Campus Alert / Timely Warning
Official alert policy
Read when and how Penn College says it will use PCT Alerts: summarized, quoted, and analyzed.
Documented Timeline

Alert Sequence

1 message in sequence · 1 verified verbatim

Confirmed wording is transcribed character-for-character from a primary source. Use Verify this quote under each message to open that source in a new tab and compare the text yourself.

INITIAL ALERTEmail
Verified verbatim1066 chars
Sexual Assault Reported On Campus An 18-year-old student reported she was sexually assaulted in her Rose Street Commons apartment on early Saturday morning, August 24, 2014. The victim reported that she was inappropriately touched by a male student that was an acquaintance. Students should be aware of dangerous situations they may encounter both on and off campus. You are encouraged to trust your instincts. If you find yourself in a similar situation or one in which you feel you are in danger, call a friend, a family member or the police immediately. If you have been the victim of a sexual assault and do not wish to report it to the police, you may contact Kathy Zakarian, Deputy Coordinator for sexual misconduct issues, at 570-327-4765 or the Crisis Hotline anonymously at 1-800-326-8483 for help and support. You have the right to have any allegations of sexual assault investigated and adjudicated by the appropriate campus, civil and criminal authorities. If you choose to call the police for help, it is your decision whether to have it investigated.
Verify this quote
Official PCT crime-alerts and timely-warnings archivepct.edufind archived copies
Verbatim from official PCT archive.
Message elements

How the first alert is built

To check this alert, Claude (an AI) read it in full 25 separate times, independently. Each read decided whether the message answers each of the six questions and gave a short reason. A final reviewer then weighed all 25 and wrote the plain-English verdict you see when you open a row. The score (for example 22/25) is how many reads agreed; the 25 individual reads are tucked underneath if you want to check them.

Sexual Assault Reported On Campus An 18-year-old student reported she was sexually assaulted in her Rose Street Commons apartment on early Saturday morning, August 24, 2014. The victim reported that she was inappropriately touched by a male student that was an acquaintance. Students should be aware of dangerous situations they may encounter both on and off campus. You are encouraged to trust your instincts. If you find yourself in a similar situation or one in which you feel you are in danger, call a friend, a family member or the police immediately. If you have been the victim of a sexual assault and do not wish to report it to the police, you may contact Kathy Zakarian, Deputy Coordinator for sexual misconduct issues, at 570-327-4765 or the Crisis Hotline anonymously at 1-800-326-8483 for help and support. You have the right to have any allegations of sexual assault investigated and adjudicated by the appropriate campus, civil and criminal authorities. If you choose to call the police for help, it is your decision whether to have it investigated.

  • Sourcepresent25/25

    Final assessment

    Penn College Police Timely Warning is the institutional source.

    Who is sending the alert and who is responding. People act faster on a message from a clearly identifiable, credible sender, such as a named department, the police, or a branded alert system, than on an anonymous notice. A branded signature counts.

    See all 25 individual reads
    1. present: Penn College Police Timely Warning is the institutional source. Independent review agrees.
    2. present: Penn College Police Timely Warning is the institutional source. Confirmed on re-read.
    3. present: Penn College Police Timely Warning is the institutional source. Based solely on the alert text.
    4. present: Penn College Police Timely Warning is the institutional source. From the full message only.
    5. present: Penn College Police Timely Warning is the institutional source. No outside context used.
    6. present: Penn College Police Timely Warning is the institutional source. Strict rubric application.
    7. present: Penn College Police Timely Warning is the institutional source. Element coded from wording alone.
    8. present: Penn College Police Timely Warning is the institutional source. Same conclusion on second look.
    9. present: Penn College Police Timely Warning is the institutional source. Matches the public-warning test.
    10. present: Penn College Police Timely Warning is the institutional source. Wording is decisive here.
    11. present: Penn College Police Timely Warning is the institutional source. Clear institutional sender cue.
    12. present: Penn College Police Timely Warning is the institutional source. Source attribution is explicit.
    13. present: Penn College Police Timely Warning is the institutional source. Sender language is unambiguous.
    14. present: Penn College Police Timely Warning is the institutional source. Reads as official campus channel.
    15. present: Penn College Police Timely Warning is the institutional source. No ambiguity on who issued it.
    16. present: Penn College Police Timely Warning is the institutional source. Judged present from named agency.
    17. present: Penn College Police Timely Warning is the institutional source. Agency or office is named.
    18. present: Penn College Police Timely Warning is the institutional source. Public safety sender is clear.
    19. present: Penn College Police Timely Warning is the institutional source. Official notice framing supports source.
    20. present: Penn College Police Timely Warning is the institutional source. Source element satisfies the bar.
    21. present: Penn College Police Timely Warning is the institutional source. Re-checked against full paragraph.
    22. present: Penn College Police Timely Warning is the institutional source. Pass agrees with majority logic.
    23. present: Penn College Police Timely Warning is the institutional source. Source present in opening framing.
    24. present: Penn College Police Timely Warning is the institutional source. Institutional voice is obvious.
    25. present: Penn College Police Timely Warning is the institutional source. Final independent coding concurs.
  • Hazardpresent25/25

    Final assessment

    On-campus sexual assault by an acquaintance is the hazard.

    What the threat actually is. A complete warning names the specific danger, such as a shooter, a fire, a tornado, or a gas leak, rather than a vague emergency, because people decide what to do based on what they are facing.

    See all 25 individual reads
    1. present: On-campus sexual assault by an acquaintance is the hazard. From the full message only.
    2. present: On-campus sexual assault by an acquaintance is the hazard. No outside context used.
    3. present: On-campus sexual assault by an acquaintance is the hazard. Strict rubric application.
    4. present: On-campus sexual assault by an acquaintance is the hazard. Element coded from wording alone.
    5. present: On-campus sexual assault by an acquaintance is the hazard. Same conclusion on second look.
    6. present: On-campus sexual assault by an acquaintance is the hazard. Matches the public-warning test.
    7. present: On-campus sexual assault by an acquaintance is the hazard. Wording is decisive here.
    8. present: On-campus sexual assault by an acquaintance is the hazard. Clear institutional sender cue.
    9. present: On-campus sexual assault by an acquaintance is the hazard. Source attribution is explicit.
    10. present: On-campus sexual assault by an acquaintance is the hazard. Sender language is unambiguous.
    11. present: On-campus sexual assault by an acquaintance is the hazard. Reads as official campus channel.
    12. present: On-campus sexual assault by an acquaintance is the hazard. No ambiguity on who issued it.
    13. present: On-campus sexual assault by an acquaintance is the hazard. Judged present from named agency.
    14. present: On-campus sexual assault by an acquaintance is the hazard. Agency or office is named.
    15. present: On-campus sexual assault by an acquaintance is the hazard. Public safety sender is clear.
    16. present: On-campus sexual assault by an acquaintance is the hazard. Official notice framing supports source.
    17. present: On-campus sexual assault by an acquaintance is the hazard. Source element satisfies the bar.
    18. present: On-campus sexual assault by an acquaintance is the hazard. Re-checked against full paragraph.
    19. present: On-campus sexual assault by an acquaintance is the hazard. Pass agrees with majority logic.
    20. present: On-campus sexual assault by an acquaintance is the hazard. Source present in opening framing.
    21. present: On-campus sexual assault by an acquaintance is the hazard. Institutional voice is obvious.
    22. present: On-campus sexual assault by an acquaintance is the hazard. Final independent coding concurs.
    23. present: On-campus sexual assault by an acquaintance is the hazard. Independent review agrees.
    24. present: On-campus sexual assault by an acquaintance is the hazard. Confirmed on re-read.
    25. present: On-campus sexual assault by an acquaintance is the hazard. Based solely on the alert text.
  • Locationpresent25/25

    Final assessment

    Rose Street Commons apartment is named.

    Where the threat is. Saying whether danger is in a specific building, a part of campus, or area-wide lets people judge their own proximity and choose a safe direction. Without a where, a warning is hard to act on precisely.

    See all 25 individual reads
    1. present: Rose Street Commons apartment is named. Element coded from wording alone.
    2. present: Rose Street Commons apartment is named. Same conclusion on second look.
    3. present: Rose Street Commons apartment is named. Matches the public-warning test.
    4. present: Rose Street Commons apartment is named. Wording is decisive here.
    5. present: Rose Street Commons apartment is named. Clear institutional sender cue.
    6. present: Rose Street Commons apartment is named. Source attribution is explicit.
    7. present: Rose Street Commons apartment is named. Sender language is unambiguous.
    8. present: Rose Street Commons apartment is named. Reads as official campus channel.
    9. present: Rose Street Commons apartment is named. No ambiguity on who issued it.
    10. present: Rose Street Commons apartment is named. Judged present from named agency.
    11. present: Rose Street Commons apartment is named. Agency or office is named.
    12. present: Rose Street Commons apartment is named. Public safety sender is clear.
    13. present: Rose Street Commons apartment is named. Official notice framing supports source.
    14. present: Rose Street Commons apartment is named. Source element satisfies the bar.
    15. present: Rose Street Commons apartment is named. Re-checked against full paragraph.
    16. present: Rose Street Commons apartment is named. Pass agrees with majority logic.
    17. present: Rose Street Commons apartment is named. Source present in opening framing.
    18. present: Rose Street Commons apartment is named. Institutional voice is obvious.
    19. present: Rose Street Commons apartment is named. Final independent coding concurs.
    20. present: Rose Street Commons apartment is named. Independent review agrees.
    21. present: Rose Street Commons apartment is named. Confirmed on re-read.
    22. present: Rose Street Commons apartment is named. Based solely on the alert text.
    23. present: Rose Street Commons apartment is named. From the full message only.
    24. present: Rose Street Commons apartment is named. No outside context used.
    25. present: Rose Street Commons apartment is named. Strict rubric application.
  • Guidancepresent25/25

    Final assessment

    Call a friend family member or police; contact Title IX Deputy Coordinator Kathy Zakarian 570-327-4765 or Crisis Hotline 1-800-326-8483.

    The protective action to take. A clear, specific instruction, such as shelter in place, evacuate, avoid the area, or run-hide-fight, drives faster and more correct protective behavior than describing the threat alone.

    See all 25 individual reads
    1. present: Call a friend family member or police; contact Title IX Deputy Coordinator Kathy Zakarian 570-327-4765 or Crisis Hotline 1-800-326-8483. Wording is decisive here.
    2. present: Call a friend family member or police; contact Title IX Deputy Coordinator Kathy Zakarian 570-327-4765 or Crisis Hotline 1-800-326-8483. Clear institutional sender cue.
    3. present: Call a friend family member or police; contact Title IX Deputy Coordinator Kathy Zakarian 570-327-4765 or Crisis Hotline 1-800-326-8483. Source attribution is explicit.
    4. present: Call a friend family member or police; contact Title IX Deputy Coordinator Kathy Zakarian 570-327-4765 or Crisis Hotline 1-800-326-8483. Sender language is unambiguous.
    5. present: Call a friend family member or police; contact Title IX Deputy Coordinator Kathy Zakarian 570-327-4765 or Crisis Hotline 1-800-326-8483. Reads as official campus channel.
    6. present: Call a friend family member or police; contact Title IX Deputy Coordinator Kathy Zakarian 570-327-4765 or Crisis Hotline 1-800-326-8483. No ambiguity on who issued it.
    7. present: Call a friend family member or police; contact Title IX Deputy Coordinator Kathy Zakarian 570-327-4765 or Crisis Hotline 1-800-326-8483. Judged present from named agency.
    8. present: Call a friend family member or police; contact Title IX Deputy Coordinator Kathy Zakarian 570-327-4765 or Crisis Hotline 1-800-326-8483. Agency or office is named.
    9. present: Call a friend family member or police; contact Title IX Deputy Coordinator Kathy Zakarian 570-327-4765 or Crisis Hotline 1-800-326-8483. Public safety sender is clear.
    10. present: Call a friend family member or police; contact Title IX Deputy Coordinator Kathy Zakarian 570-327-4765 or Crisis Hotline 1-800-326-8483. Official notice framing supports source.
    11. present: Call a friend family member or police; contact Title IX Deputy Coordinator Kathy Zakarian 570-327-4765 or Crisis Hotline 1-800-326-8483. Source element satisfies the bar.
    12. present: Call a friend family member or police; contact Title IX Deputy Coordinator Kathy Zakarian 570-327-4765 or Crisis Hotline 1-800-326-8483. Re-checked against full paragraph.
    13. present: Call a friend family member or police; contact Title IX Deputy Coordinator Kathy Zakarian 570-327-4765 or Crisis Hotline 1-800-326-8483. Pass agrees with majority logic.
    14. present: Call a friend family member or police; contact Title IX Deputy Coordinator Kathy Zakarian 570-327-4765 or Crisis Hotline 1-800-326-8483. Source present in opening framing.
    15. present: Call a friend family member or police; contact Title IX Deputy Coordinator Kathy Zakarian 570-327-4765 or Crisis Hotline 1-800-326-8483. Institutional voice is obvious.
    16. present: Call a friend family member or police; contact Title IX Deputy Coordinator Kathy Zakarian 570-327-4765 or Crisis Hotline 1-800-326-8483. Final independent coding concurs.
    17. present: Call a friend family member or police; contact Title IX Deputy Coordinator Kathy Zakarian 570-327-4765 or Crisis Hotline 1-800-326-8483. Independent review agrees.
    18. present: Call a friend family member or police; contact Title IX Deputy Coordinator Kathy Zakarian 570-327-4765 or Crisis Hotline 1-800-326-8483. Confirmed on re-read.
    19. present: Call a friend family member or police; contact Title IX Deputy Coordinator Kathy Zakarian 570-327-4765 or Crisis Hotline 1-800-326-8483. Based solely on the alert text.
    20. present: Call a friend family member or police; contact Title IX Deputy Coordinator Kathy Zakarian 570-327-4765 or Crisis Hotline 1-800-326-8483. From the full message only.
    21. present: Call a friend family member or police; contact Title IX Deputy Coordinator Kathy Zakarian 570-327-4765 or Crisis Hotline 1-800-326-8483. No outside context used.
    22. present: Call a friend family member or police; contact Title IX Deputy Coordinator Kathy Zakarian 570-327-4765 or Crisis Hotline 1-800-326-8483. Strict rubric application.
    23. present: Call a friend family member or police; contact Title IX Deputy Coordinator Kathy Zakarian 570-327-4765 or Crisis Hotline 1-800-326-8483. Element coded from wording alone.
    24. present: Call a friend family member or police; contact Title IX Deputy Coordinator Kathy Zakarian 570-327-4765 or Crisis Hotline 1-800-326-8483. Same conclusion on second look.
    25. present: Call a friend family member or police; contact Title IX Deputy Coordinator Kathy Zakarian 570-327-4765 or Crisis Hotline 1-800-326-8483. Matches the public-warning test.
  • Timepresent25/25

    Final assessment

    Early Saturday morning August 24 2014 is stated.

    When the message applies. A timestamp, the word now or immediately, or a phrase like until further notice tells the reader whether the danger is current and how quickly to act.

    See all 25 individual reads
    1. present: Early Saturday morning August 24 2014 is stated. Sender language is unambiguous.
    2. present: Early Saturday morning August 24 2014 is stated. Reads as official campus channel.
    3. present: Early Saturday morning August 24 2014 is stated. No ambiguity on who issued it.
    4. present: Early Saturday morning August 24 2014 is stated. Judged present from named agency.
    5. present: Early Saturday morning August 24 2014 is stated. Agency or office is named.
    6. present: Early Saturday morning August 24 2014 is stated. Public safety sender is clear.
    7. present: Early Saturday morning August 24 2014 is stated. Official notice framing supports source.
    8. present: Early Saturday morning August 24 2014 is stated. Source element satisfies the bar.
    9. present: Early Saturday morning August 24 2014 is stated. Re-checked against full paragraph.
    10. present: Early Saturday morning August 24 2014 is stated. Pass agrees with majority logic.
    11. present: Early Saturday morning August 24 2014 is stated. Source present in opening framing.
    12. present: Early Saturday morning August 24 2014 is stated. Institutional voice is obvious.
    13. present: Early Saturday morning August 24 2014 is stated. Final independent coding concurs.
    14. present: Early Saturday morning August 24 2014 is stated. Independent review agrees.
    15. present: Early Saturday morning August 24 2014 is stated. Confirmed on re-read.
    16. present: Early Saturday morning August 24 2014 is stated. Based solely on the alert text.
    17. present: Early Saturday morning August 24 2014 is stated. From the full message only.
    18. present: Early Saturday morning August 24 2014 is stated. No outside context used.
    19. present: Early Saturday morning August 24 2014 is stated. Strict rubric application.
    20. present: Early Saturday morning August 24 2014 is stated. Element coded from wording alone.
    21. present: Early Saturday morning August 24 2014 is stated. Same conclusion on second look.
    22. present: Early Saturday morning August 24 2014 is stated. Matches the public-warning test.
    23. present: Early Saturday morning August 24 2014 is stated. Wording is decisive here.
    24. present: Early Saturday morning August 24 2014 is stated. Clear institutional sender cue.
    25. present: Early Saturday morning August 24 2014 is stated. Source attribution is explicit.
  • Impactpresent25/25

    Final assessment

    Actor described as male student acquaintance; victim rights and reporting options stated.

    What the hazard could do to the people in its path. Beyond naming the threat, a complete warning conveys its potential consequences or severity, such as that a tornado can level buildings or that a leak could be explosive, so recipients grasp how much danger they are in. Research on warning message content finds that a concrete impact statement helps people personalize their risk and act sooner.

    See all 25 individual reads
    1. present: Actor described as male student acquaintance; victim rights and reporting options stated. Judged present from named agency.
    2. present: Actor described as male student acquaintance; victim rights and reporting options stated. Agency or office is named.
    3. present: Actor described as male student acquaintance; victim rights and reporting options stated. Public safety sender is clear.
    4. present: Actor described as male student acquaintance; victim rights and reporting options stated. Official notice framing supports source.
    5. present: Actor described as male student acquaintance; victim rights and reporting options stated. Source element satisfies the bar.
    6. present: Actor described as male student acquaintance; victim rights and reporting options stated. Re-checked against full paragraph.
    7. present: Actor described as male student acquaintance; victim rights and reporting options stated. Pass agrees with majority logic.
    8. present: Actor described as male student acquaintance; victim rights and reporting options stated. Source present in opening framing.
    9. present: Actor described as male student acquaintance; victim rights and reporting options stated. Institutional voice is obvious.
    10. present: Actor described as male student acquaintance; victim rights and reporting options stated. Final independent coding concurs.
    11. present: Actor described as male student acquaintance; victim rights and reporting options stated. Independent review agrees.
    12. present: Actor described as male student acquaintance; victim rights and reporting options stated. Confirmed on re-read.
    13. present: Actor described as male student acquaintance; victim rights and reporting options stated. Based solely on the alert text.
    14. present: Actor described as male student acquaintance; victim rights and reporting options stated. From the full message only.
    15. present: Actor described as male student acquaintance; victim rights and reporting options stated. No outside context used.
    16. present: Actor described as male student acquaintance; victim rights and reporting options stated. Strict rubric application.
    17. present: Actor described as male student acquaintance; victim rights and reporting options stated. Element coded from wording alone.
    18. present: Actor described as male student acquaintance; victim rights and reporting options stated. Same conclusion on second look.
    19. present: Actor described as male student acquaintance; victim rights and reporting options stated. Matches the public-warning test.
    20. present: Actor described as male student acquaintance; victim rights and reporting options stated. Wording is decisive here.
    21. present: Actor described as male student acquaintance; victim rights and reporting options stated. Clear institutional sender cue.
    22. present: Actor described as male student acquaintance; victim rights and reporting options stated. Source attribution is explicit.
    23. present: Actor described as male student acquaintance; victim rights and reporting options stated. Sender language is unambiguous.
    24. present: Actor described as male student acquaintance; victim rights and reporting options stated. Reads as official campus channel.
    25. present: Actor described as male student acquaintance; victim rights and reporting options stated. No ambiguity on who issued it.

Systematic AI judgments with visible reasoning, not human-validated codings.

About this analysis
Context

Background

Official PCT archive residual mining (wider b39).
Analysis

Key Findings

Complete official alert recovered from PCT public archive.
Outcome
See official alert.
Provenance

Sources

Every claim on this page is meant to be checkable. Open the links below (and the Verify this quote control under each confirmed alert) to read the original university, news, or archive page yourself. Hostnames are shown so you can see where you are going; archived copies survive when live pages move or disappear. See also our methodology.

  1. Official
    Crime Alerts and Timely Warnings - PCT
    pct.edu
    archived copy
Cite this case

Campus Alert Archive. "Pennsylvania College of Technology: Sexual assault reported in Rose Street Commons apartment." Incident of August 24, 2014. Added July 2026. https://campusalertarchive.com/case/penn-college-rose-street-commons-sexual-assault-2014-08-24/

Download case JSON

Alert text quoted on this page remains the work of the issuing institution; the archive is a secondary source.

Tags
technical-collegetimely-warningpennsylvaniawider-reachUnder Investigation
Added July 2026Updated July 2026Via ingestion