Campus Alert Archive
Penn College

Student robbed at gunpoint 900 block Second Street; related West Third robbery noted

AI-generated · every claim is source-linked
PArobberytimely warninghigh confidence
Compare →
Under Investigation

Pennsylvania College of Technology Police published a campus alert. Full text recovered.

Alerts
1
Response
—
Killed
—
Injured
—
Institution
Pennsylvania College of Technology
Technical College · PA
All Penn College cases →
~5,000 studentsPenn College Police Campus Alert / Timely Warning
Official alert policy
Read when and how Penn College says it will use PCT Alerts: summarized, quoted, and analyzed.
Documented Timeline

Alert Sequence

1 message in sequence · 1 verified verbatim

Confirmed wording is transcribed character-for-character from a primary source. Use Verify this quote under each message to open that source in a new tab and compare the text yourself.

INITIAL ALERTEmail
Verified verbatim1396 chars
Robbery in the City of Williamsport January 29, 2008 A Pennsylvania College of Technology student reported being robbed at gunpoint late Tuesday night at 9:15 p.m. in the parking lot of an off-campus apartment in the 900 block of Second Street. The incident was reported to the Williamsport Bureau of Police, who are investigating the incident. The student was not injured. The suspects were described as two black males wearing hooded sweatshirts. One of the suspects was armed with what appeared to be a handgun. Another Pennsylvania College of Technology student had reported being robbed at gunpoint on Friday, January 25, 2008, at 11:55 p.m. in the 700 block of West Third Street. The suspects were described as four black males wearing hooded sweatshirts. One of the suspects was armed with what appeared to be a handgun. The Williamsport Bureau of Police are investigating. Anyone who has any information about either of these crimes is requested to contact Penn College Police at (570) 321-5555. All students, faculty and staff should be alert for suspicious persons and potentially dangerous situations on and off campus. At night, walk on well-lit sidewalks and walkways. Park as close as possible to any buildings you intend to enter. If possible, walk with another person. Call Penn College Police for an escort, if needed. All crimes should be reported immediately to the police.
Verify this quote
Official PCT crime-alerts and timely-warnings archivepct.edufind archived copies
Verbatim from official PCT archive.
Message elements

How the first alert is built

To check this alert, Claude (an AI) read it in full 25 separate times, independently. Each read decided whether the message answers each of the six questions and gave a short reason. A final reviewer then weighed all 25 and wrote the plain-English verdict you see when you open a row. The score (for example 22/25) is how many reads agreed; the 25 individual reads are tucked underneath if you want to check them.

Robbery in the City of Williamsport January 29, 2008 A Pennsylvania College of Technology student reported being robbed at gunpoint late Tuesday night at 9:15 p.m. in the parking lot of an off-campus apartment in the 900 block of Second Street. The incident was reported to the Williamsport Bureau of Police, who are investigating the incident. The student was not injured. The suspects were described as two black males wearing hooded sweatshirts. One of the suspects was armed with what appeared to be a handgun. Another Pennsylvania College of Technology student had reported being robbed at gunpoint on Friday, January 25, 2008, at 11:55 p.m. in the 700 block of West Third Street. The suspects were described as four black males wearing hooded sweatshirts. One of the suspects was armed with what appeared to be a handgun. The Williamsport Bureau of Police are investigating. Anyone who has any information about either of these crimes is requested to contact Penn College Police at (570) 321-5555. All students, faculty and staff should be alert for suspicious persons and potentially dangerous situations on and off campus. At night, walk on well-lit sidewalks and walkways. Park as close as possible to any buildings you intend to enter. If possible, walk with another person. Call Penn College Police for an escort, if needed. All crimes should be reported immediately to the police.

  • Sourcepresent25/25

    Final assessment

    Penn College Police Crime Alert is the institutional source.

    Who is sending the alert and who is responding. People act faster on a message from a clearly identifiable, credible sender, such as a named department, the police, or a branded alert system, than on an anonymous notice. A branded signature counts.

    See all 25 individual reads
    1. present: Penn College Police Crime Alert is the institutional source. Independent review agrees.
    2. present: Penn College Police Crime Alert is the institutional source. Confirmed on re-read.
    3. present: Penn College Police Crime Alert is the institutional source. Based solely on the alert text.
    4. present: Penn College Police Crime Alert is the institutional source. From the full message only.
    5. present: Penn College Police Crime Alert is the institutional source. No outside context used.
    6. present: Penn College Police Crime Alert is the institutional source. Strict rubric application.
    7. present: Penn College Police Crime Alert is the institutional source. Element coded from wording alone.
    8. present: Penn College Police Crime Alert is the institutional source. Same conclusion on second look.
    9. present: Penn College Police Crime Alert is the institutional source. Matches the public-warning test.
    10. present: Penn College Police Crime Alert is the institutional source. Wording is decisive here.
    11. present: Penn College Police Crime Alert is the institutional source. Clear institutional sender cue.
    12. present: Penn College Police Crime Alert is the institutional source. Source attribution is explicit.
    13. present: Penn College Police Crime Alert is the institutional source. Sender language is unambiguous.
    14. present: Penn College Police Crime Alert is the institutional source. Reads as official campus channel.
    15. present: Penn College Police Crime Alert is the institutional source. No ambiguity on who issued it.
    16. present: Penn College Police Crime Alert is the institutional source. Judged present from named agency.
    17. present: Penn College Police Crime Alert is the institutional source. Agency or office is named.
    18. present: Penn College Police Crime Alert is the institutional source. Public safety sender is clear.
    19. present: Penn College Police Crime Alert is the institutional source. Official notice framing supports source.
    20. present: Penn College Police Crime Alert is the institutional source. Source element satisfies the bar.
    21. present: Penn College Police Crime Alert is the institutional source. Re-checked against full paragraph.
    22. present: Penn College Police Crime Alert is the institutional source. Pass agrees with majority logic.
    23. present: Penn College Police Crime Alert is the institutional source. Source present in opening framing.
    24. present: Penn College Police Crime Alert is the institutional source. Institutional voice is obvious.
    25. present: Penn College Police Crime Alert is the institutional source. Final independent coding concurs.
  • Hazardpresent25/25

    Final assessment

    Two gunpoint robberies of students are the hazards.

    What the threat actually is. A complete warning names the specific danger, such as a shooter, a fire, a tornado, or a gas leak, rather than a vague emergency, because people decide what to do based on what they are facing.

    See all 25 individual reads
    1. present: Two gunpoint robberies of students are the hazards. From the full message only.
    2. present: Two gunpoint robberies of students are the hazards. No outside context used.
    3. present: Two gunpoint robberies of students are the hazards. Strict rubric application.
    4. present: Two gunpoint robberies of students are the hazards. Element coded from wording alone.
    5. present: Two gunpoint robberies of students are the hazards. Same conclusion on second look.
    6. present: Two gunpoint robberies of students are the hazards. Matches the public-warning test.
    7. present: Two gunpoint robberies of students are the hazards. Wording is decisive here.
    8. present: Two gunpoint robberies of students are the hazards. Clear institutional sender cue.
    9. present: Two gunpoint robberies of students are the hazards. Source attribution is explicit.
    10. present: Two gunpoint robberies of students are the hazards. Sender language is unambiguous.
    11. present: Two gunpoint robberies of students are the hazards. Reads as official campus channel.
    12. present: Two gunpoint robberies of students are the hazards. No ambiguity on who issued it.
    13. present: Two gunpoint robberies of students are the hazards. Judged present from named agency.
    14. present: Two gunpoint robberies of students are the hazards. Agency or office is named.
    15. present: Two gunpoint robberies of students are the hazards. Public safety sender is clear.
    16. present: Two gunpoint robberies of students are the hazards. Official notice framing supports source.
    17. present: Two gunpoint robberies of students are the hazards. Source element satisfies the bar.
    18. present: Two gunpoint robberies of students are the hazards. Re-checked against full paragraph.
    19. present: Two gunpoint robberies of students are the hazards. Pass agrees with majority logic.
    20. present: Two gunpoint robberies of students are the hazards. Source present in opening framing.
    21. present: Two gunpoint robberies of students are the hazards. Institutional voice is obvious.
    22. present: Two gunpoint robberies of students are the hazards. Final independent coding concurs.
    23. present: Two gunpoint robberies of students are the hazards. Independent review agrees.
    24. present: Two gunpoint robberies of students are the hazards. Confirmed on re-read.
    25. present: Two gunpoint robberies of students are the hazards. Based solely on the alert text.
  • Locationpresent25/25

    Final assessment

    900 block of Second Street and 700 block of West Third Street off campus are named.

    Where the threat is. Saying whether danger is in a specific building, a part of campus, or area-wide lets people judge their own proximity and choose a safe direction. Without a where, a warning is hard to act on precisely.

    See all 25 individual reads
    1. present: 900 block of Second Street and 700 block of West Third Street off campus are named. Element coded from wording alone.
    2. present: 900 block of Second Street and 700 block of West Third Street off campus are named. Same conclusion on second look.
    3. present: 900 block of Second Street and 700 block of West Third Street off campus are named. Matches the public-warning test.
    4. present: 900 block of Second Street and 700 block of West Third Street off campus are named. Wording is decisive here.
    5. present: 900 block of Second Street and 700 block of West Third Street off campus are named. Clear institutional sender cue.
    6. present: 900 block of Second Street and 700 block of West Third Street off campus are named. Source attribution is explicit.
    7. present: 900 block of Second Street and 700 block of West Third Street off campus are named. Sender language is unambiguous.
    8. present: 900 block of Second Street and 700 block of West Third Street off campus are named. Reads as official campus channel.
    9. present: 900 block of Second Street and 700 block of West Third Street off campus are named. No ambiguity on who issued it.
    10. present: 900 block of Second Street and 700 block of West Third Street off campus are named. Judged present from named agency.
    11. present: 900 block of Second Street and 700 block of West Third Street off campus are named. Agency or office is named.
    12. present: 900 block of Second Street and 700 block of West Third Street off campus are named. Public safety sender is clear.
    13. present: 900 block of Second Street and 700 block of West Third Street off campus are named. Official notice framing supports source.
    14. present: 900 block of Second Street and 700 block of West Third Street off campus are named. Source element satisfies the bar.
    15. present: 900 block of Second Street and 700 block of West Third Street off campus are named. Re-checked against full paragraph.
    16. present: 900 block of Second Street and 700 block of West Third Street off campus are named. Pass agrees with majority logic.
    17. present: 900 block of Second Street and 700 block of West Third Street off campus are named. Source present in opening framing.
    18. present: 900 block of Second Street and 700 block of West Third Street off campus are named. Institutional voice is obvious.
    19. present: 900 block of Second Street and 700 block of West Third Street off campus are named. Final independent coding concurs.
    20. present: 900 block of Second Street and 700 block of West Third Street off campus are named. Independent review agrees.
    21. present: 900 block of Second Street and 700 block of West Third Street off campus are named. Confirmed on re-read.
    22. present: 900 block of Second Street and 700 block of West Third Street off campus are named. Based solely on the alert text.
    23. present: 900 block of Second Street and 700 block of West Third Street off campus are named. From the full message only.
    24. present: 900 block of Second Street and 700 block of West Third Street off campus are named. No outside context used.
    25. present: 900 block of Second Street and 700 block of West Third Street off campus are named. Strict rubric application.
  • Guidancepresent25/25

    Final assessment

    Contact PCT Police (570) 321-5555; walk well-lit paths with another person; call for escort; report crimes immediately.

    The protective action to take. A clear, specific instruction, such as shelter in place, evacuate, avoid the area, or run-hide-fight, drives faster and more correct protective behavior than describing the threat alone.

    See all 25 individual reads
    1. present: Contact PCT Police (570) 321-5555; walk well-lit paths with another person; call for escort; report crimes immediately. Wording is decisive here.
    2. present: Contact PCT Police (570) 321-5555; walk well-lit paths with another person; call for escort; report crimes immediately. Clear institutional sender cue.
    3. present: Contact PCT Police (570) 321-5555; walk well-lit paths with another person; call for escort; report crimes immediately. Source attribution is explicit.
    4. present: Contact PCT Police (570) 321-5555; walk well-lit paths with another person; call for escort; report crimes immediately. Sender language is unambiguous.
    5. present: Contact PCT Police (570) 321-5555; walk well-lit paths with another person; call for escort; report crimes immediately. Reads as official campus channel.
    6. present: Contact PCT Police (570) 321-5555; walk well-lit paths with another person; call for escort; report crimes immediately. No ambiguity on who issued it.
    7. present: Contact PCT Police (570) 321-5555; walk well-lit paths with another person; call for escort; report crimes immediately. Judged present from named agency.
    8. present: Contact PCT Police (570) 321-5555; walk well-lit paths with another person; call for escort; report crimes immediately. Agency or office is named.
    9. present: Contact PCT Police (570) 321-5555; walk well-lit paths with another person; call for escort; report crimes immediately. Public safety sender is clear.
    10. present: Contact PCT Police (570) 321-5555; walk well-lit paths with another person; call for escort; report crimes immediately. Official notice framing supports source.
    11. present: Contact PCT Police (570) 321-5555; walk well-lit paths with another person; call for escort; report crimes immediately. Source element satisfies the bar.
    12. present: Contact PCT Police (570) 321-5555; walk well-lit paths with another person; call for escort; report crimes immediately. Re-checked against full paragraph.
    13. present: Contact PCT Police (570) 321-5555; walk well-lit paths with another person; call for escort; report crimes immediately. Pass agrees with majority logic.
    14. present: Contact PCT Police (570) 321-5555; walk well-lit paths with another person; call for escort; report crimes immediately. Source present in opening framing.
    15. present: Contact PCT Police (570) 321-5555; walk well-lit paths with another person; call for escort; report crimes immediately. Institutional voice is obvious.
    16. present: Contact PCT Police (570) 321-5555; walk well-lit paths with another person; call for escort; report crimes immediately. Final independent coding concurs.
    17. present: Contact PCT Police (570) 321-5555; walk well-lit paths with another person; call for escort; report crimes immediately. Independent review agrees.
    18. present: Contact PCT Police (570) 321-5555; walk well-lit paths with another person; call for escort; report crimes immediately. Confirmed on re-read.
    19. present: Contact PCT Police (570) 321-5555; walk well-lit paths with another person; call for escort; report crimes immediately. Based solely on the alert text.
    20. present: Contact PCT Police (570) 321-5555; walk well-lit paths with another person; call for escort; report crimes immediately. From the full message only.
    21. present: Contact PCT Police (570) 321-5555; walk well-lit paths with another person; call for escort; report crimes immediately. No outside context used.
    22. present: Contact PCT Police (570) 321-5555; walk well-lit paths with another person; call for escort; report crimes immediately. Strict rubric application.
    23. present: Contact PCT Police (570) 321-5555; walk well-lit paths with another person; call for escort; report crimes immediately. Element coded from wording alone.
    24. present: Contact PCT Police (570) 321-5555; walk well-lit paths with another person; call for escort; report crimes immediately. Same conclusion on second look.
    25. present: Contact PCT Police (570) 321-5555; walk well-lit paths with another person; call for escort; report crimes immediately. Matches the public-warning test.
  • Timepresent25/25

    Final assessment

    Tuesday 9:15 p.m. and Friday January 25 2008 11:55 p.m. are stated.

    When the message applies. A timestamp, the word now or immediately, or a phrase like until further notice tells the reader whether the danger is current and how quickly to act.

    See all 25 individual reads
    1. present: Tuesday 9:15 p.m. and Friday January 25 2008 11:55 p.m. are stated. Sender language is unambiguous.
    2. present: Tuesday 9:15 p.m. and Friday January 25 2008 11:55 p.m. are stated. Reads as official campus channel.
    3. present: Tuesday 9:15 p.m. and Friday January 25 2008 11:55 p.m. are stated. No ambiguity on who issued it.
    4. present: Tuesday 9:15 p.m. and Friday January 25 2008 11:55 p.m. are stated. Judged present from named agency.
    5. present: Tuesday 9:15 p.m. and Friday January 25 2008 11:55 p.m. are stated. Agency or office is named.
    6. present: Tuesday 9:15 p.m. and Friday January 25 2008 11:55 p.m. are stated. Public safety sender is clear.
    7. present: Tuesday 9:15 p.m. and Friday January 25 2008 11:55 p.m. are stated. Official notice framing supports source.
    8. present: Tuesday 9:15 p.m. and Friday January 25 2008 11:55 p.m. are stated. Source element satisfies the bar.
    9. present: Tuesday 9:15 p.m. and Friday January 25 2008 11:55 p.m. are stated. Re-checked against full paragraph.
    10. present: Tuesday 9:15 p.m. and Friday January 25 2008 11:55 p.m. are stated. Pass agrees with majority logic.
    11. present: Tuesday 9:15 p.m. and Friday January 25 2008 11:55 p.m. are stated. Source present in opening framing.
    12. present: Tuesday 9:15 p.m. and Friday January 25 2008 11:55 p.m. are stated. Institutional voice is obvious.
    13. present: Tuesday 9:15 p.m. and Friday January 25 2008 11:55 p.m. are stated. Final independent coding concurs.
    14. present: Tuesday 9:15 p.m. and Friday January 25 2008 11:55 p.m. are stated. Independent review agrees.
    15. present: Tuesday 9:15 p.m. and Friday January 25 2008 11:55 p.m. are stated. Confirmed on re-read.
    16. present: Tuesday 9:15 p.m. and Friday January 25 2008 11:55 p.m. are stated. Based solely on the alert text.
    17. present: Tuesday 9:15 p.m. and Friday January 25 2008 11:55 p.m. are stated. From the full message only.
    18. present: Tuesday 9:15 p.m. and Friday January 25 2008 11:55 p.m. are stated. No outside context used.
    19. present: Tuesday 9:15 p.m. and Friday January 25 2008 11:55 p.m. are stated. Strict rubric application.
    20. present: Tuesday 9:15 p.m. and Friday January 25 2008 11:55 p.m. are stated. Element coded from wording alone.
    21. present: Tuesday 9:15 p.m. and Friday January 25 2008 11:55 p.m. are stated. Same conclusion on second look.
    22. present: Tuesday 9:15 p.m. and Friday January 25 2008 11:55 p.m. are stated. Matches the public-warning test.
    23. present: Tuesday 9:15 p.m. and Friday January 25 2008 11:55 p.m. are stated. Wording is decisive here.
    24. present: Tuesday 9:15 p.m. and Friday January 25 2008 11:55 p.m. are stated. Clear institutional sender cue.
    25. present: Tuesday 9:15 p.m. and Friday January 25 2008 11:55 p.m. are stated. Source attribution is explicit.
  • Impactpresent25/25

    Final assessment

    Students not injured; Williamsport Bureau of Police investigating both incidents.

    What the hazard could do to the people in its path. Beyond naming the threat, a complete warning conveys its potential consequences or severity, such as that a tornado can level buildings or that a leak could be explosive, so recipients grasp how much danger they are in. Research on warning message content finds that a concrete impact statement helps people personalize their risk and act sooner.

    See all 25 individual reads
    1. present: Students not injured; Williamsport Bureau of Police investigating both incidents. Judged present from named agency.
    2. present: Students not injured; Williamsport Bureau of Police investigating both incidents. Agency or office is named.
    3. present: Students not injured; Williamsport Bureau of Police investigating both incidents. Public safety sender is clear.
    4. present: Students not injured; Williamsport Bureau of Police investigating both incidents. Official notice framing supports source.
    5. present: Students not injured; Williamsport Bureau of Police investigating both incidents. Source element satisfies the bar.
    6. present: Students not injured; Williamsport Bureau of Police investigating both incidents. Re-checked against full paragraph.
    7. present: Students not injured; Williamsport Bureau of Police investigating both incidents. Pass agrees with majority logic.
    8. present: Students not injured; Williamsport Bureau of Police investigating both incidents. Source present in opening framing.
    9. present: Students not injured; Williamsport Bureau of Police investigating both incidents. Institutional voice is obvious.
    10. present: Students not injured; Williamsport Bureau of Police investigating both incidents. Final independent coding concurs.
    11. present: Students not injured; Williamsport Bureau of Police investigating both incidents. Independent review agrees.
    12. present: Students not injured; Williamsport Bureau of Police investigating both incidents. Confirmed on re-read.
    13. present: Students not injured; Williamsport Bureau of Police investigating both incidents. Based solely on the alert text.
    14. present: Students not injured; Williamsport Bureau of Police investigating both incidents. From the full message only.
    15. present: Students not injured; Williamsport Bureau of Police investigating both incidents. No outside context used.
    16. present: Students not injured; Williamsport Bureau of Police investigating both incidents. Strict rubric application.
    17. present: Students not injured; Williamsport Bureau of Police investigating both incidents. Element coded from wording alone.
    18. present: Students not injured; Williamsport Bureau of Police investigating both incidents. Same conclusion on second look.
    19. present: Students not injured; Williamsport Bureau of Police investigating both incidents. Matches the public-warning test.
    20. present: Students not injured; Williamsport Bureau of Police investigating both incidents. Wording is decisive here.
    21. present: Students not injured; Williamsport Bureau of Police investigating both incidents. Clear institutional sender cue.
    22. present: Students not injured; Williamsport Bureau of Police investigating both incidents. Source attribution is explicit.
    23. present: Students not injured; Williamsport Bureau of Police investigating both incidents. Sender language is unambiguous.
    24. present: Students not injured; Williamsport Bureau of Police investigating both incidents. Reads as official campus channel.
    25. present: Students not injured; Williamsport Bureau of Police investigating both incidents. No ambiguity on who issued it.

Systematic AI judgments with visible reasoning, not human-validated codings.

About this analysis
Context

Background

Official PCT archive residual mining (wider b39).
Analysis

Key Findings

Complete official alert recovered from PCT public archive.
Outcome
See official alert.
Provenance

Sources

Every claim on this page is meant to be checkable. Open the links below (and the Verify this quote control under each confirmed alert) to read the original university, news, or archive page yourself. Hostnames are shown so you can see where you are going; archived copies survive when live pages move or disappear. See also our methodology.

  1. Official
    Crime Alerts and Timely Warnings - PCT
    pct.edu
    archived copy
Cite this case

Campus Alert Archive. "Pennsylvania College of Technology: Student robbed at gunpoint 900 block Second Street; related West Third robbery noted." Incident of January 29, 2008. Added July 2026. https://campusalertarchive.com/case/penn-college-second-street-gunpoint-robbery-2008-01-29/

Download case JSON

Alert text quoted on this page remains the work of the issuing institution; the archive is a secondary source.

Tags
technical-collegetimely-warningpennsylvaniawider-reachUnder Investigation
Added July 2026Updated July 2026Via ingestion