Campus Alert Archive
Penn College

Off-campus shooting north of campus 400 block Third Avenue

AI-generated · every claim is source-linked
PAshootingemergency notificationhigh confidence
Compare →
Under Investigation

Pennsylvania College of Technology Police published a campus alert. Full text recovered.

Alerts
1
Response
—
Killed
—
Injured
—
Institution
Pennsylvania College of Technology
Technical College · PA
All Penn College cases →
~5,000 studentsPenn College Police Campus Alert / Timely Warning
Official alert policy
Read when and how Penn College says it will use PCT Alerts: summarized, quoted, and analyzed.
Documented Timeline

Alert Sequence

1 message in sequence · 1 verified verbatim

Confirmed wording is transcribed character-for-character from a primary source. Use Verify this quote under each message to open that source in a new tab and compare the text yourself.

INITIAL ALERTEmail
Verified verbatim846 chars
Off Campus Shooting On Thursday, September 4, at 1:30 a.m., College Police and Williamsport Bureau of Police responded to a shooting north of campus in the 400 block of Third Avenue. A College police officer encountered a shooting victim (non-student) at the intersection of Maynard Street and West 4th Street. He told the officer someone had shot him on Third Avenue. Police found evidence of drug activity in the apartment where the shooting occurred. Several students may have been in the area at the time of the incident. Anyone having more information are encourage to contact the Williamsport Bureau of Police at 570-327-7560 or Penn College Police at 570-321-5555. Williamsport Bureau of Police are investigating. College Police would like to remind students to report supicious persons or activity immediately to police by dialing 911.
Verify this quote
Official PCT crime-alerts and timely-warnings archivepct.edufind archived copies
Verbatim from official PCT archive.
Message elements

How the first alert is built

To check this alert, Claude (an AI) read it in full 25 separate times, independently. Each read decided whether the message answers each of the six questions and gave a short reason. A final reviewer then weighed all 25 and wrote the plain-English verdict you see when you open a row. The score (for example 22/25) is how many reads agreed; the 25 individual reads are tucked underneath if you want to check them.

Off Campus Shooting On Thursday, September 4, at 1:30 a.m., College Police and Williamsport Bureau of Police responded to a shooting north of campus in the 400 block of Third Avenue. A College police officer encountered a shooting victim (non-student) at the intersection of Maynard Street and West 4th Street. He told the officer someone had shot him on Third Avenue. Police found evidence of drug activity in the apartment where the shooting occurred. Several students may have been in the area at the time of the incident. Anyone having more information are encourage to contact the Williamsport Bureau of Police at 570-327-7560 or Penn College Police at 570-321-5555. Williamsport Bureau of Police are investigating. College Police would like to remind students to report supicious persons or activity immediately to police by dialing 911.

  • Sourcepresent25/25

    Final assessment

    Penn College Police / College Police Crime Alert is the institutional source.

    Who is sending the alert and who is responding. People act faster on a message from a clearly identifiable, credible sender, such as a named department, the police, or a branded alert system, than on an anonymous notice. A branded signature counts.

    See all 25 individual reads
    1. present: Penn College Police / College Police Crime Alert is the institutional source. Independent review agrees.
    2. present: Penn College Police / College Police Crime Alert is the institutional source. Confirmed on re-read.
    3. present: Penn College Police / College Police Crime Alert is the institutional source. Based solely on the alert text.
    4. present: Penn College Police / College Police Crime Alert is the institutional source. From the full message only.
    5. present: Penn College Police / College Police Crime Alert is the institutional source. No outside context used.
    6. present: Penn College Police / College Police Crime Alert is the institutional source. Strict rubric application.
    7. present: Penn College Police / College Police Crime Alert is the institutional source. Element coded from wording alone.
    8. present: Penn College Police / College Police Crime Alert is the institutional source. Same conclusion on second look.
    9. present: Penn College Police / College Police Crime Alert is the institutional source. Matches the public-warning test.
    10. present: Penn College Police / College Police Crime Alert is the institutional source. Wording is decisive here.
    11. present: Penn College Police / College Police Crime Alert is the institutional source. Clear institutional sender cue.
    12. present: Penn College Police / College Police Crime Alert is the institutional source. Source attribution is explicit.
    13. present: Penn College Police / College Police Crime Alert is the institutional source. Sender language is unambiguous.
    14. present: Penn College Police / College Police Crime Alert is the institutional source. Reads as official campus channel.
    15. present: Penn College Police / College Police Crime Alert is the institutional source. No ambiguity on who issued it.
    16. present: Penn College Police / College Police Crime Alert is the institutional source. Judged present from named agency.
    17. present: Penn College Police / College Police Crime Alert is the institutional source. Agency or office is named.
    18. present: Penn College Police / College Police Crime Alert is the institutional source. Public safety sender is clear.
    19. present: Penn College Police / College Police Crime Alert is the institutional source. Official notice framing supports source.
    20. present: Penn College Police / College Police Crime Alert is the institutional source. Source element satisfies the bar.
    21. present: Penn College Police / College Police Crime Alert is the institutional source. Re-checked against full paragraph.
    22. present: Penn College Police / College Police Crime Alert is the institutional source. Pass agrees with majority logic.
    23. present: Penn College Police / College Police Crime Alert is the institutional source. Source present in opening framing.
    24. present: Penn College Police / College Police Crime Alert is the institutional source. Institutional voice is obvious.
    25. present: Penn College Police / College Police Crime Alert is the institutional source. Final independent coding concurs.
  • Hazardpresent25/25

    Final assessment

    Off-campus shooting with injury is the hazard.

    What the threat actually is. A complete warning names the specific danger, such as a shooter, a fire, a tornado, or a gas leak, rather than a vague emergency, because people decide what to do based on what they are facing.

    See all 25 individual reads
    1. present: Off-campus shooting with injury is the hazard. From the full message only.
    2. present: Off-campus shooting with injury is the hazard. No outside context used.
    3. present: Off-campus shooting with injury is the hazard. Strict rubric application.
    4. present: Off-campus shooting with injury is the hazard. Element coded from wording alone.
    5. present: Off-campus shooting with injury is the hazard. Same conclusion on second look.
    6. present: Off-campus shooting with injury is the hazard. Matches the public-warning test.
    7. present: Off-campus shooting with injury is the hazard. Wording is decisive here.
    8. present: Off-campus shooting with injury is the hazard. Clear institutional sender cue.
    9. present: Off-campus shooting with injury is the hazard. Source attribution is explicit.
    10. present: Off-campus shooting with injury is the hazard. Sender language is unambiguous.
    11. present: Off-campus shooting with injury is the hazard. Reads as official campus channel.
    12. present: Off-campus shooting with injury is the hazard. No ambiguity on who issued it.
    13. present: Off-campus shooting with injury is the hazard. Judged present from named agency.
    14. present: Off-campus shooting with injury is the hazard. Agency or office is named.
    15. present: Off-campus shooting with injury is the hazard. Public safety sender is clear.
    16. present: Off-campus shooting with injury is the hazard. Official notice framing supports source.
    17. present: Off-campus shooting with injury is the hazard. Source element satisfies the bar.
    18. present: Off-campus shooting with injury is the hazard. Re-checked against full paragraph.
    19. present: Off-campus shooting with injury is the hazard. Pass agrees with majority logic.
    20. present: Off-campus shooting with injury is the hazard. Source present in opening framing.
    21. present: Off-campus shooting with injury is the hazard. Institutional voice is obvious.
    22. present: Off-campus shooting with injury is the hazard. Final independent coding concurs.
    23. present: Off-campus shooting with injury is the hazard. Independent review agrees.
    24. present: Off-campus shooting with injury is the hazard. Confirmed on re-read.
    25. present: Off-campus shooting with injury is the hazard. Based solely on the alert text.
  • Locationpresent25/25

    Final assessment

    400 block of Third Avenue; Maynard Street and West 4th Street intersection is named.

    Where the threat is. Saying whether danger is in a specific building, a part of campus, or area-wide lets people judge their own proximity and choose a safe direction. Without a where, a warning is hard to act on precisely.

    See all 25 individual reads
    1. present: 400 block of Third Avenue; Maynard Street and West 4th Street intersection is named. Element coded from wording alone.
    2. present: 400 block of Third Avenue; Maynard Street and West 4th Street intersection is named. Same conclusion on second look.
    3. present: 400 block of Third Avenue; Maynard Street and West 4th Street intersection is named. Matches the public-warning test.
    4. present: 400 block of Third Avenue; Maynard Street and West 4th Street intersection is named. Wording is decisive here.
    5. present: 400 block of Third Avenue; Maynard Street and West 4th Street intersection is named. Clear institutional sender cue.
    6. present: 400 block of Third Avenue; Maynard Street and West 4th Street intersection is named. Source attribution is explicit.
    7. present: 400 block of Third Avenue; Maynard Street and West 4th Street intersection is named. Sender language is unambiguous.
    8. present: 400 block of Third Avenue; Maynard Street and West 4th Street intersection is named. Reads as official campus channel.
    9. present: 400 block of Third Avenue; Maynard Street and West 4th Street intersection is named. No ambiguity on who issued it.
    10. present: 400 block of Third Avenue; Maynard Street and West 4th Street intersection is named. Judged present from named agency.
    11. present: 400 block of Third Avenue; Maynard Street and West 4th Street intersection is named. Agency or office is named.
    12. present: 400 block of Third Avenue; Maynard Street and West 4th Street intersection is named. Public safety sender is clear.
    13. present: 400 block of Third Avenue; Maynard Street and West 4th Street intersection is named. Official notice framing supports source.
    14. present: 400 block of Third Avenue; Maynard Street and West 4th Street intersection is named. Source element satisfies the bar.
    15. present: 400 block of Third Avenue; Maynard Street and West 4th Street intersection is named. Re-checked against full paragraph.
    16. present: 400 block of Third Avenue; Maynard Street and West 4th Street intersection is named. Pass agrees with majority logic.
    17. present: 400 block of Third Avenue; Maynard Street and West 4th Street intersection is named. Source present in opening framing.
    18. present: 400 block of Third Avenue; Maynard Street and West 4th Street intersection is named. Institutional voice is obvious.
    19. present: 400 block of Third Avenue; Maynard Street and West 4th Street intersection is named. Final independent coding concurs.
    20. present: 400 block of Third Avenue; Maynard Street and West 4th Street intersection is named. Independent review agrees.
    21. present: 400 block of Third Avenue; Maynard Street and West 4th Street intersection is named. Confirmed on re-read.
    22. present: 400 block of Third Avenue; Maynard Street and West 4th Street intersection is named. Based solely on the alert text.
    23. present: 400 block of Third Avenue; Maynard Street and West 4th Street intersection is named. From the full message only.
    24. present: 400 block of Third Avenue; Maynard Street and West 4th Street intersection is named. No outside context used.
    25. present: 400 block of Third Avenue; Maynard Street and West 4th Street intersection is named. Strict rubric application.
  • Guidancepresent25/25

    Final assessment

    Contact Williamsport Police 570-327-7560 or PCT Police 570-321-5555; report suspicious activity by dialing 911.

    The protective action to take. A clear, specific instruction, such as shelter in place, evacuate, avoid the area, or run-hide-fight, drives faster and more correct protective behavior than describing the threat alone.

    See all 25 individual reads
    1. present: Contact Williamsport Police 570-327-7560 or PCT Police 570-321-5555; report suspicious activity by dialing 911. Wording is decisive here.
    2. present: Contact Williamsport Police 570-327-7560 or PCT Police 570-321-5555; report suspicious activity by dialing 911. Clear institutional sender cue.
    3. present: Contact Williamsport Police 570-327-7560 or PCT Police 570-321-5555; report suspicious activity by dialing 911. Source attribution is explicit.
    4. present: Contact Williamsport Police 570-327-7560 or PCT Police 570-321-5555; report suspicious activity by dialing 911. Sender language is unambiguous.
    5. present: Contact Williamsport Police 570-327-7560 or PCT Police 570-321-5555; report suspicious activity by dialing 911. Reads as official campus channel.
    6. present: Contact Williamsport Police 570-327-7560 or PCT Police 570-321-5555; report suspicious activity by dialing 911. No ambiguity on who issued it.
    7. present: Contact Williamsport Police 570-327-7560 or PCT Police 570-321-5555; report suspicious activity by dialing 911. Judged present from named agency.
    8. present: Contact Williamsport Police 570-327-7560 or PCT Police 570-321-5555; report suspicious activity by dialing 911. Agency or office is named.
    9. present: Contact Williamsport Police 570-327-7560 or PCT Police 570-321-5555; report suspicious activity by dialing 911. Public safety sender is clear.
    10. present: Contact Williamsport Police 570-327-7560 or PCT Police 570-321-5555; report suspicious activity by dialing 911. Official notice framing supports source.
    11. present: Contact Williamsport Police 570-327-7560 or PCT Police 570-321-5555; report suspicious activity by dialing 911. Source element satisfies the bar.
    12. present: Contact Williamsport Police 570-327-7560 or PCT Police 570-321-5555; report suspicious activity by dialing 911. Re-checked against full paragraph.
    13. present: Contact Williamsport Police 570-327-7560 or PCT Police 570-321-5555; report suspicious activity by dialing 911. Pass agrees with majority logic.
    14. present: Contact Williamsport Police 570-327-7560 or PCT Police 570-321-5555; report suspicious activity by dialing 911. Source present in opening framing.
    15. present: Contact Williamsport Police 570-327-7560 or PCT Police 570-321-5555; report suspicious activity by dialing 911. Institutional voice is obvious.
    16. present: Contact Williamsport Police 570-327-7560 or PCT Police 570-321-5555; report suspicious activity by dialing 911. Final independent coding concurs.
    17. present: Contact Williamsport Police 570-327-7560 or PCT Police 570-321-5555; report suspicious activity by dialing 911. Independent review agrees.
    18. present: Contact Williamsport Police 570-327-7560 or PCT Police 570-321-5555; report suspicious activity by dialing 911. Confirmed on re-read.
    19. present: Contact Williamsport Police 570-327-7560 or PCT Police 570-321-5555; report suspicious activity by dialing 911. Based solely on the alert text.
    20. present: Contact Williamsport Police 570-327-7560 or PCT Police 570-321-5555; report suspicious activity by dialing 911. From the full message only.
    21. present: Contact Williamsport Police 570-327-7560 or PCT Police 570-321-5555; report suspicious activity by dialing 911. No outside context used.
    22. present: Contact Williamsport Police 570-327-7560 or PCT Police 570-321-5555; report suspicious activity by dialing 911. Strict rubric application.
    23. present: Contact Williamsport Police 570-327-7560 or PCT Police 570-321-5555; report suspicious activity by dialing 911. Element coded from wording alone.
    24. present: Contact Williamsport Police 570-327-7560 or PCT Police 570-321-5555; report suspicious activity by dialing 911. Same conclusion on second look.
    25. present: Contact Williamsport Police 570-327-7560 or PCT Police 570-321-5555; report suspicious activity by dialing 911. Matches the public-warning test.
  • Timepresent25/25

    Final assessment

    Thursday September 4 at 1:30 a.m. is stated.

    When the message applies. A timestamp, the word now or immediately, or a phrase like until further notice tells the reader whether the danger is current and how quickly to act.

    See all 25 individual reads
    1. present: Thursday September 4 at 1:30 a.m. is stated. Sender language is unambiguous.
    2. present: Thursday September 4 at 1:30 a.m. is stated. Reads as official campus channel.
    3. present: Thursday September 4 at 1:30 a.m. is stated. No ambiguity on who issued it.
    4. present: Thursday September 4 at 1:30 a.m. is stated. Judged present from named agency.
    5. present: Thursday September 4 at 1:30 a.m. is stated. Agency or office is named.
    6. present: Thursday September 4 at 1:30 a.m. is stated. Public safety sender is clear.
    7. present: Thursday September 4 at 1:30 a.m. is stated. Official notice framing supports source.
    8. present: Thursday September 4 at 1:30 a.m. is stated. Source element satisfies the bar.
    9. present: Thursday September 4 at 1:30 a.m. is stated. Re-checked against full paragraph.
    10. present: Thursday September 4 at 1:30 a.m. is stated. Pass agrees with majority logic.
    11. present: Thursday September 4 at 1:30 a.m. is stated. Source present in opening framing.
    12. present: Thursday September 4 at 1:30 a.m. is stated. Institutional voice is obvious.
    13. present: Thursday September 4 at 1:30 a.m. is stated. Final independent coding concurs.
    14. present: Thursday September 4 at 1:30 a.m. is stated. Independent review agrees.
    15. present: Thursday September 4 at 1:30 a.m. is stated. Confirmed on re-read.
    16. present: Thursday September 4 at 1:30 a.m. is stated. Based solely on the alert text.
    17. present: Thursday September 4 at 1:30 a.m. is stated. From the full message only.
    18. present: Thursday September 4 at 1:30 a.m. is stated. No outside context used.
    19. present: Thursday September 4 at 1:30 a.m. is stated. Strict rubric application.
    20. present: Thursday September 4 at 1:30 a.m. is stated. Element coded from wording alone.
    21. present: Thursday September 4 at 1:30 a.m. is stated. Same conclusion on second look.
    22. present: Thursday September 4 at 1:30 a.m. is stated. Matches the public-warning test.
    23. present: Thursday September 4 at 1:30 a.m. is stated. Wording is decisive here.
    24. present: Thursday September 4 at 1:30 a.m. is stated. Clear institutional sender cue.
    25. present: Thursday September 4 at 1:30 a.m. is stated. Source attribution is explicit.
  • Impactpresent25/25

    Final assessment

    Victim non-student; drug activity evidence found; Williamsport Bureau of Police investigating.

    What the hazard could do to the people in its path. Beyond naming the threat, a complete warning conveys its potential consequences or severity, such as that a tornado can level buildings or that a leak could be explosive, so recipients grasp how much danger they are in. Research on warning message content finds that a concrete impact statement helps people personalize their risk and act sooner.

    See all 25 individual reads
    1. present: Victim non-student; drug activity evidence found; Williamsport Bureau of Police investigating. Judged present from named agency.
    2. present: Victim non-student; drug activity evidence found; Williamsport Bureau of Police investigating. Agency or office is named.
    3. present: Victim non-student; drug activity evidence found; Williamsport Bureau of Police investigating. Public safety sender is clear.
    4. present: Victim non-student; drug activity evidence found; Williamsport Bureau of Police investigating. Official notice framing supports source.
    5. present: Victim non-student; drug activity evidence found; Williamsport Bureau of Police investigating. Source element satisfies the bar.
    6. present: Victim non-student; drug activity evidence found; Williamsport Bureau of Police investigating. Re-checked against full paragraph.
    7. present: Victim non-student; drug activity evidence found; Williamsport Bureau of Police investigating. Pass agrees with majority logic.
    8. present: Victim non-student; drug activity evidence found; Williamsport Bureau of Police investigating. Source present in opening framing.
    9. present: Victim non-student; drug activity evidence found; Williamsport Bureau of Police investigating. Institutional voice is obvious.
    10. present: Victim non-student; drug activity evidence found; Williamsport Bureau of Police investigating. Final independent coding concurs.
    11. present: Victim non-student; drug activity evidence found; Williamsport Bureau of Police investigating. Independent review agrees.
    12. present: Victim non-student; drug activity evidence found; Williamsport Bureau of Police investigating. Confirmed on re-read.
    13. present: Victim non-student; drug activity evidence found; Williamsport Bureau of Police investigating. Based solely on the alert text.
    14. present: Victim non-student; drug activity evidence found; Williamsport Bureau of Police investigating. From the full message only.
    15. present: Victim non-student; drug activity evidence found; Williamsport Bureau of Police investigating. No outside context used.
    16. present: Victim non-student; drug activity evidence found; Williamsport Bureau of Police investigating. Strict rubric application.
    17. present: Victim non-student; drug activity evidence found; Williamsport Bureau of Police investigating. Element coded from wording alone.
    18. present: Victim non-student; drug activity evidence found; Williamsport Bureau of Police investigating. Same conclusion on second look.
    19. present: Victim non-student; drug activity evidence found; Williamsport Bureau of Police investigating. Matches the public-warning test.
    20. present: Victim non-student; drug activity evidence found; Williamsport Bureau of Police investigating. Wording is decisive here.
    21. present: Victim non-student; drug activity evidence found; Williamsport Bureau of Police investigating. Clear institutional sender cue.
    22. present: Victim non-student; drug activity evidence found; Williamsport Bureau of Police investigating. Source attribution is explicit.
    23. present: Victim non-student; drug activity evidence found; Williamsport Bureau of Police investigating. Sender language is unambiguous.
    24. present: Victim non-student; drug activity evidence found; Williamsport Bureau of Police investigating. Reads as official campus channel.
    25. present: Victim non-student; drug activity evidence found; Williamsport Bureau of Police investigating. No ambiguity on who issued it.

Systematic AI judgments with visible reasoning, not human-validated codings.

About this analysis
Context

Background

Official PCT archive residual mining (wider b39).
Analysis

Key Findings

Complete official alert recovered from PCT public archive.
Outcome
See official alert.
Provenance

Sources

Every claim on this page is meant to be checkable. Open the links below (and the Verify this quote control under each confirmed alert) to read the original university, news, or archive page yourself. Hostnames are shown so you can see where you are going; archived copies survive when live pages move or disappear. See also our methodology.

  1. Official
    Crime Alerts and Timely Warnings - PCT
    pct.edu
    archived copy
Cite this case

Campus Alert Archive. "Pennsylvania College of Technology: Off-campus shooting north of campus 400 block Third Avenue." Incident of September 4, 2014. Added July 2026. https://campusalertarchive.com/case/penn-college-third-avenue-off-campus-shooting-2014-09-04/

Download case JSON

Alert text quoted on this page remains the work of the issuing institution; the archive is a secondary source.

Tags
technical-collegetimely-warningpennsylvaniawider-reachUnder Investigation
Added July 2026Updated July 2026Via ingestion