Skip to content
Campus Alert Archive
Temple

Disease outbreak, March 22, 2019

AI-generated · every claim is source-linked
PAdisease outbreakadvisoryhigh confidence
Confirmed Threat

Temple University experienced one of the largest U.S. campus mumps outbreaks of the decade starting in February 2019, ultimately producing 186 confirmed cases in students, faculty, and people connected to the university. The university issued its first FAQ alert on March 22, 2019 after the Philadelphia Department of Public Health flagged a cluster, then ran multiple mass vaccination clinics that administered more than 6,000 MMR doses, including 2,285 in a single day.

Alerts
2
Response
Killed
0
Injured
186
Institution
Temple University
Public R1 · PA
All Temple cases →
~39,000 studentsTemple Now / Student and Employee Health Services
Official alert policy
Read when and how Temple says it will use TUalert: summarized, quoted, and analyzed.
Documented Timeline

Alert Sequence

2 messages in sequence · 1 verified verbatim

Some messages in this sequence are documented (their existence, timing, and channel are sourced) but their exact wording is not preserved in the public record. Those entries appear as placeholders; only confirmed text is displayed.

INITIAL ALERTEmail
What is the mumps?Mumps is a highly infectious disease passed through saliva and respiratory secretions. While the incubation period is 12 to 25 days, symptoms often appear 16 to 18 days after exposure. What are the symptoms?The symptoms for the mumps are similar to influenza (the flu) and often include tender swollen glands below the ear and along the jawline on one or both sides of the face and neck, headache, fever and cold-like symptoms. People with mumps are considered infectious from two days before swelling begins through five days after the start of swelling. How is the disease spread?It is spread through direct contact with saliva or respiratory droplets, and generally, people are most contagious about one to two days before their salivary glands become swollen and painful. It s most contagious during that flu-like period before the salivary gland swelling. How many mumps cases have occurred since the outbreak at Temple University began?As of May 3, 171 cases of mumps have been diagnosed among both Temple students and people outside Temple. If someone shows symptoms, how do they treat the mumps?Management for mumps is similar to that of flu. There is no treatment, only relief of symptoms. Take Motrin or Tylenol for fever and swelling, drink plenty of fluids and get plenty of rest. One of the most important steps you can take if you experience symptoms is to self-isolate, avoid travel and limit contact with others for five days from the onset of symptoms. For healthy people, there is very little risk of serious complications from the mumps. How can someone prevent contracting the mumps?Avoid close contact with individuals who present symptoms. Wash hands frequently and efficiently. When unable to wash with soap and water, use an alcohol-based hand sanitizer. Avoid sharing food and drinks or participating in other activities that may result in saliva exposure. Avoid sharing devices like smart phones. Arrange for delivery of food and groceries. Those who are showing symptoms are encouraged to cover their mouth with a tissue when coughing or sneezing; use an upper sleeve to cover a cough, not one s hand. Most importantly, those with mumps symptoms should stay home from school or work to rest and limit the spread of illness to others. What are the university s official recommendations?If you have had close contact with someone symptomatic with the mumps and have never received the Measles, Mumps, Rubella (MMR) vaccine, the recommendation is to receive the full two-dose MMR series. If you have had close contact with someone symptomatic with the mumps and have previously received the MMR vaccine, the recommendation is to receive a third booster dose of the vaccine. The third booster dose is not recommended unless you have had close contact with a symptomatic person. If you are immunocompromised or pregnant, please contact your doctor immediately. How much does the vaccine cost and where is it available?Temple Student and Employee Health Services offered two walk-in clinics March 27 and March 29 at which the MMR vaccine was available at no charge. The clinics, offered in conjunction with the Philadelphia Department of Public Health, administered 4,819 doses of the vaccine. Anyone who could not attend the clinic is encouraged to call Temple Student and Employee Health Services to arrange an appointment to receive the vaccine at no charge. Is the MMR vaccine you receive as a first or second dose different from the booster?No, it is the same exact vaccine, it is just called a booster because you ve already had previous doses. Is the university refunding students and employees who paid for the vaccine?Yes. Students or employees who previously paid for the vaccine at Temple Student and Employee Health Services are being notified and refunds will be made. Do you need to receive the vaccine again if you ve previously received it?The Centers for Disease Control and Prevention cites an 88 percent effectiveness rate for individuals who previously received two doses of the MMR vaccine. A range of effectiveness, anywhere from 66 to 95 percent, exists within that figure and is subject to fluctuation based upon multiple criteria. Additionally, the effectiveness of the vaccine is shown to diminish over time. According to the CDC, it is safe to receive a third dose of the vaccine to prevent against future contraction of mumps and boost individual immunity to the disease. Does the university require the mumps vaccine for enrollment?Temple University is updating its immunization policy for prematriculation to require the following: The policy is still under development. The goal is to draft the policy over the summer for rollout next academic year. The university fully expects the policy to be in accordance with best practices and applicable law. And accordingly, the university expects avenues for appropriate opt-out that will be spelled out when the policy is final. An online petition is encouraging the temporary closure of Temple University. Why isn t the university closing?No conversations regarding university closure have taken place. Additionally, the Philadelphia Department of Public Health does not recommend closing the university, as the department believes such a measure will not stop the ongoing spread of mumps. Since it takes weeks for symptoms to develop, people who were exposed and present symptoms will still be able to spread the disease following an extended university closure. The best measure for preventing the spread of mumps is for symptomatic individuals to self-isolate for five days.
Reflects Temple's emphasis that vaccinated people can still contract mumps as immunity wanes, a key public health message of this outbreak
Mentions vaping devices because Philadelphia public health investigators traced shared vaping as a transmission pathway
UPDATEEmail
Wording not preservedOfficial page: now.temple.edu
A update message is documented at this point in the sequence, but its exact wording is not preserved in the public record. The public edition displays only confirmed alert text.
Message elements

How the first alert is built

To check this alert, Claude (an AI) read it in full 25 separate times, independently. Each read decided whether the message answers each of the six questions and gave a short reason. A final reviewer then weighed all 25 and wrote the plain-English verdict you see when you open a row. The score (for example 22/25) is how many reads agreed; the 25 individual reads are tucked underneath if you want to check them.

What is the mumps?Mumps is a highly infectious disease passed through saliva and respiratory secretions. While the incubation period is 12 to 25 days, symptoms often appear 16 to 18 days after exposure. What are the symptoms?The symptoms for the mumps are similar to influenza (the flu) and often include tender swollen glands below the ear and along the jawline on one or both sides of the face and neck, headache, fever and cold-like symptoms. People with mumps are considered infectious from two days before swelling begins through five days after the start of swelling. How is the disease spread?It is spread through direct contact with saliva or respiratory droplets, and generally, people are most contagious about one to two days before their salivary glands become swollen and painful. It s most contagious during that flu-like period before the salivary gland swelling. How many mumps cases have occurred since the outbreak at Temple University began?As of May 3, 171 cases of mumps have been diagnosed among both Temple students and people outside Temple. If someone shows symptoms, how do they treat the mumps?Management for mumps is similar to that of flu. There is no treatment, only relief of symptoms. Take Motrin or Tylenol for fever and swelling, drink plenty of fluids and get plenty of rest. One of the most important steps you can take if you experience symptoms is to self-isolate, avoid travel and limit contact with others for five days from the onset of symptoms. For healthy people, there is very little risk of serious complications from the mumps. How can someone prevent contracting the mumps?Avoid close contact with individuals who present symptoms. Wash hands frequently and efficiently. When unable to wash with soap and water, use an alcohol-based hand sanitizer. Avoid sharing food and drinks or participating in other activities that may result in saliva exposure. Avoid sharing devices like smart phones. Arrange for delivery of food and groceries. Those who are showing symptoms are encouraged to cover their mouth with a tissue when coughing or sneezing; use an upper sleeve to cover a cough, not one s hand. Most importantly, those with mumps symptoms should stay home from school or work to rest and limit the spread of illness to others. What are the university s official recommendations?If you have had close contact with someone symptomatic with the mumps and have never received the Measles, Mumps, Rubella (MMR) vaccine, the recommendation is to receive the full two-dose MMR series. If you have had close contact with someone symptomatic with the mumps and have previously received the MMR vaccine, the recommendation is to receive a third booster dose of the vaccine. The third booster dose is not recommended unless you have had close contact with a symptomatic person. If you are immunocompromised or pregnant, please contact your doctor immediately. How much does the vaccine cost and where is it available?Temple Student and Employee Health Services offered two walk-in clinics March 27 and March 29 at which the MMR vaccine was available at no charge. The clinics, offered in conjunction with the Philadelphia Department of Public Health, administered 4,819 doses of the vaccine. Anyone who could not attend the clinic is encouraged to call Temple Student and Employee Health Services to arrange an appointment to receive the vaccine at no charge. Is the MMR vaccine you receive as a first or second dose different from the booster?No, it is the same exact vaccine, it is just called a booster because you ve already had previous doses. Is the university refunding students and employees who paid for the vaccine?Yes. Students or employees who previously paid for the vaccine at Temple Student and Employee Health Services are being notified and refunds will be made. Do you need to receive the vaccine again if you ve previously received it?The Centers for Disease Control and Prevention cites an 88 percent effectiveness rate for individuals who previously received two doses of the MMR vaccine. A range of effectiveness, anywhere from 66 to 95 percent, exists within that figure and is subject to fluctuation based upon multiple criteria. Additionally, the effectiveness of the vaccine is shown to diminish over time. According to the CDC, it is safe to receive a third dose of the vaccine to prevent against future contraction of mumps and boost individual immunity to the disease. Does the university require the mumps vaccine for enrollment?Temple University is updating its immunization policy for prematriculation to require the following: The policy is still under development. The goal is to draft the policy over the summer for rollout next academic year. The university fully expects the policy to be in accordance with best practices and applicable law. And accordingly, the university expects avenues for appropriate opt-out that will be spelled out when the policy is final. An online petition is encouraging the temporary closure of Temple University. Why isn t the university closing?No conversations regarding university closure have taken place. Additionally, the Philadelphia Department of Public Health does not recommend closing the university, as the department believes such a measure will not stop the ongoing spread of mumps. Since it takes weeks for symptoms to develop, people who were exposed and present symptoms will still be able to spread the disease following an extended university closure. The best measure for preventing the spread of mumps is for symptomatic individuals to self-isolate for five days.

  • Sourceabsent0/0

    Who is sending the alert and who is responding. People act faster on a message from a clearly identifiable, credible sender, such as a named department, the police, or a branded alert system, than on an anonymous notice. A branded signature counts.

    See all 25 individual reads

    Open to load the 25 reads.

  • Hazardabsent0/0

    What the threat actually is. A complete warning names the specific danger, such as a shooter, a fire, a tornado, or a gas leak, rather than a vague emergency, because people decide what to do based on what they are facing.

    See all 25 individual reads

    Open to load the 25 reads.

  • Locationabsent0/0

    Where the threat is. Saying whether danger is in a specific building, a part of campus, or area-wide lets people judge their own proximity and choose a safe direction. Without a where, a warning is hard to act on precisely.

    See all 25 individual reads

    Open to load the 25 reads.

  • Guidanceabsent0/0

    The protective action to take. A clear, specific instruction, such as shelter in place, evacuate, avoid the area, or run-hide-fight, drives faster and more correct protective behavior than describing the threat alone.

    See all 25 individual reads

    Open to load the 25 reads.

  • Timeabsent0/0

    When the message applies. A timestamp, the word now or immediately, or a phrase like until further notice tells the reader whether the danger is current and how quickly to act.

    See all 25 individual reads

    Open to load the 25 reads.

  • Impactabsent0/0

    What the hazard could do to the people in its path. Beyond naming the threat, a complete warning conveys its potential consequences or severity, such as that a tornado can level buildings or that a leak could be explosive, so recipients grasp how much danger they are in. Research on warning message content finds that a concrete impact statement helps people personalize their risk and act sooner.

    See all 25 individual reads

    Open to load the 25 reads.

Systematic AI judgments with visible reasoning, not human-validated codings.

About this analysis
Context

Background

Temple University's 2019 mumps outbreak became a national case study in vaccine waning and campus disease transmission. The outbreak began in February 2019 when the Philadelphia Department of Public Health sent its first health alert to medical providers, and Temple's Student and Employee Health Services issued its first university-wide notice on March 22, 2019. By the time the outbreak ended in late May, 186 confirmed cases had been identified — 175 students, 2 faculty members, and 9 individuals connected to but not affiliated with the university. According to Temple Student and Employee Health Services, the majority of confirmed cases involved members of the Temple community who had previously received the MMR vaccine, reflecting the well-documented phenomenon of waning mumps immunity in vaccinated college-age adults. Temple responded by holding mass MMR vaccination clinics across campus; one clinic at Mitten Hall delivered 2,285 doses in a single day. Over the course of the response, Student and Employee Health Services administered more than 6,000 MMR doses. The outbreak prompted Temple to announce that incoming students would be required to be vaccinated against mumps starting the following academic year, a policy change that mirrored similar moves at Indiana University, Harvard, and Ohio State following their own mumps outbreaks in 2014-2017. The outbreak is also notable because Philadelphia health investigators identified shared vaping devices as a likely transmission vector, prompting Temple to specifically warn students against sharing e-cigarettes.
Analysis

Key Findings

186 total confirmed cases, including 175 students, the largest U.S. campus mumps outbreak since OSU in 2014
Temple's MMR clinic at Mitten Hall administered 2,285 vaccinations in a single day, among the largest single-day campus vaccine events on record
The majority of confirmed cases were in previously vaccinated individuals, illustrating the well-documented waning of MMR-induced mumps immunity
Shared vaping devices were identified as a probable transmission vector, an emerging concern for campus public health
Outcome
186 confirmed mumps cases — 175 students, 2 faculty, and 9 unaffiliated individuals. No deaths or hospitalizations were reported. Temple held mass MMR vaccine clinics, ultimately requiring incoming students to be vaccinated starting the following academic year.
Provenance

Sources

  1. Official
  2. Official
  3. Source
  4. News
  5. Source
  6. News
Cite this case

Campus Alert Archive. "Temple University: Disease outbreak, March 22, 2019." Incident of March 22, 2019. Added May 2026; last updated July 2026. https://campusalertarchive.com/case/temple-university-mumps-outbreak-2019-03-22/

Download case JSON

Alert text quoted on this page remains the work of the issuing institution; the archive is a secondary source.

Tags
mumpsdisease-outbreakpublic-healthvaccinationmmrtemplepennsylvaniaphiladelphiavapingwaning-immunity
Added May 2026Updated July 2026Via ingestion