Campus Alert Archive
Temple

Two TUalerts, Two Blocks Apart, in a North Philadelphia Robbery Wave

PArobberytimely warninglow confidence
Under Investigation

In September 2022, Temple University issued TUalerts for armed robberies reported near campus at 1519 N. Sydenham Street and at 17th and Diamond Streets, telling students to use caution and avoid the areas. The incidents were part of a broader stretch of armed robberies and home invasions in the blocks around Temple that fall, several targeting students, that prompted scrutiny of how Temple's Department of Public Safety decides which incidents get TUalerts.

Alerts
2
Response
—
Killed
—
Injured
—
Institution
Temple University
Public R1 · PA
TUalert
Confirmed Timeline

Alert Sequence

2 messages in sequence

Some alert texts below are approximate reconstructions from news coverage, not confirmed verbatim transcripts. Reconstructed texts are shown in italic with a dashed border. Verified verbatim texts have a solid border and are marked accordingly.

INITIAL ALERTSMS
Approximate reconstructionReconstructed from The Temple News reporting; TUalert archive 403-blocks automated fetch123 chars
TUalert: Armed robbery reported near 1519 N. Sydenham St. Suspects fled. Use caution and avoid the area. Updates to follow.

This text has been reconstructed from news coverage and may not reflect the exact original wording.

TUalerts are deliberately terse SMS messages; The Temple News reported that Campus Safety Services weighs whether an off-campus incident represents a serious or continuing threat before issuing one, a judgment that drew student criticism in fall 2022.
The 1519 N. Sydenham Street block sits within the residential pocket west of Broad Street where many Temple students live off-campus, the geography that complicates Temple's Clery warning decisions.
FOLLOW-UPSMS
Approximate reconstructionReconstructed from The Temple News reporting; TUalert archive 403-blocks automated fetch158 chars
TUalert: Armed robbery reported at 17th & Diamond St. Suspects fled the scene. All students should use caution and avoid the area. More information to follow.

This text has been reconstructed from news coverage and may not reflect the exact original wording.

17th and Diamond is roughly two blocks from the Sydenham Street incident, reinforcing that fall 2022 robberies near Temple were geographically clustered in the same off-campus residential blocks.
The repeated 'use caution and avoid the area' phrasing is characteristic of Temple's robbery TUalerts, which prioritize an avoidance instruction over detailed suspect descriptions in the initial push.
Context

Background

Temple's main campus sits inside a dense North Philadelphia neighborhood where thousands of students live off-campus, and the TUalert system is the university's primary timely-warning channel. In fall 2022 a wave of armed robberies and home invasions near campus, several targeting students, put pressure on the Department of Public Safety's TUalert decisions; The Temple News examined how the department decides which incidents trigger an alert. The September robberies at 1519 N. Sydenham Street and 17th and Diamond Streets were two of the incidents that drew TUalerts that fall, and the university later provided updates on the crime incidents and TUalert changes.
Outcome
Temple advised students to avoid the affected areas; the robberies were among multiple off-campus incidents that fall. Arrests were later made in several related cases.
Provenance

Sources

  1. Student Paper
    How Temple's Department of Public Safety decides which incidents get TUalerts - The Temple News
    temple-news.com
  2. News
    Armed robbery, home invasion near Temple campus, 1 targeting student, police say - CBS Philadelphia
    cbsnews.com
  3. Student Paper
    Temple provides updates on crime incidents, TUalert changes - The Temple News
    temple-news.com
Tags
armed-robberytimely-warningpennsylvaniaphiladelphiatualertoff-campusrobbery-patternUnder Investigation
Added May 2026Updated May 2026Via ingestion