Skip to content
Campus Alert Archive
USNA

A Yodel Post Triggered a Lockdown at the Naval Academy, and Sweeping Officers Shot a Midshipman Who Mistook Them for the Threat

MDswattingemergency notificationmedium confidence
Confirmed HoaxDetermined to be a hoax. The institutional response is documented because it reveals how the alert system performed under a perceived real threat.

On September 11, 2025, at approximately 5:07 p.m. EDT, the U.S. Naval Academy and Naval Support Activity Annapolis went into lockdown after a post on the anonymous social-media app Yodel reported an active shooter inside Bancroft Hall. The threat was false — it had been posted from Indiana by a recently dismissed former midshipman — but during the building-clearance sweep a midshipman struck a Navy security officer with the butt of a parade rifle and was shot in the shoulder by responding officers. Both individuals were treated at a local hospital and released; the lockdown was lifted shortly after midnight.

Alerts
5
Response
Killed
0
Injured
2
Institution
United States Naval Academy
Military · MD
~4,500 studentsNSA Annapolis Mass Notification / USNA Public Affairs
Confirmed Timeline

Alert Sequence

5 messages in sequence

Some alert texts below are approximate reconstructions from news coverage, not confirmed verbatim transcripts. Reconstructed texts are shown in italic with a dashed border. Verified verbatim texts have a solid border and are marked accordingly.

INITIAL ALERTPA System
Approximate reconstruction152 chars
Attention all hands. Active threat on the Yard. Shelter in place. This is not a drill. Active threat on the Yard. Shelter in place. This is not a drill.

This text has been reconstructed from news coverage and may not reflect the exact original wording.

Reporting describes the public-address announcement as repeating the phrases 'active threat' and 'shelter in place' simultaneously across multiple loudspeakers across the Yard
5:07 p.m. EDT is the time officially logged by Naval Support Activity Annapolis as the start of the lockdown
The announcement instructed shelter in place, not evacuation — a deliberate choice driven by the report of an internal threat inside Bancroft Hall, the dormitory housing the entire 4,500-midshipman Brigade
UPDATETwitter/X+23 min
Approximate reconstruction189 chars
The U.S. Naval Academy and NSA Annapolis are currently on lockdown due to reports of a security concern. All personnel are directed to shelter in place. Avoid the area. Updates will follow.

This text has been reconstructed from news coverage and may not reflect the exact original wording.

USNA's first public confirmation of the lockdown came through social media within roughly 20-30 minutes of the loudspeaker announcement
The language 'security concern' rather than 'active shooter' reflects the Navy's deliberate caution before confirming whether the threat was credible
NSA Annapolis (Naval Support Activity Annapolis) is the operational installation that issues mass-notification messages for the Academy
UPDATETwitter/X+4h 33m
Approximate reconstruction273 chars
There is no active shooter threat at the U.S. Naval Academy. Law enforcement continues to investigate. One person was transported by helicopter with injuries and is in stable condition. The Academy remains in lockdown while we complete sweeps. Continue to shelter in place.

This text has been reconstructed from news coverage and may not reflect the exact original wording.

The 9:40 p.m. statement was the first official confirmation that the active-shooter report was false
By this point the midshipman had already been shot and medevaced; the statement did not initially disclose that the injury was a law-enforcement shooting
The Academy maintained shelter-in-place orders for another 2-plus hours while sweeps of Bancroft Hall continued
ALL CLEARTwitter/X
Approximate reconstruction248 chars
The lockdown at the U.S. Naval Academy has been lifted. Law enforcement has cleared the installation and there is no ongoing threat. Normal operations will resume. We thank the Annapolis community and our law enforcement partners for their support.

This text has been reconstructed from news coverage and may not reflect the exact original wording.

The lockdown lasted approximately 7 hours from 5:07 p.m. to just after midnight
BayNet and Fox Baltimore both reported the lockdown was 'lifted' rather than calling a formal 'all clear', but functionally this was the end-of-incident message
An FBI investigation was already underway by the time the lockdown lifted
FOLLOW-UPEmail+16h 53m
Approximate reconstruction555 chars
Yesterday's lockdown was triggered by a false report of an active shooter posted to an anonymous social media platform. We want to clarify that there was no active shooter at the Naval Academy. During the response, a midshipman in Bancroft Hall mistook law enforcement officers as a threat and was injured. The midshipman is in stable condition. A naval security officer was also injured and treated. We are reviewing our procedures and the role of misinformation in this incident. Counseling resources are available to all midshipmen, faculty, and staff.

This text has been reconstructed from news coverage and may not reflect the exact original wording.

The phrase 'We want to clarify that there was no active shooter' is directly quoted from the Friday Academy spokesperson statement
The follow-up explicitly named misinformation as a factor — language echoed by the Commandant calling it 'the biggest threat today'
Counseling resources are a standard post-incident inclusion at military installations following lockdowns
Context

Background

The U.S. Naval Academy at Annapolis, Maryland is one of the five US service academies, training approximately 4,500 midshipmen who all live in Bancroft Hall — the world's largest single dormitory. On the evening of September 11, 2025, a post on the anonymous social-media app Yodel reported an active shooter inside Bancroft Hall. The Academy went into lockdown at 5:07 p.m. EDT; loudspeakers across the Yard repeatedly announced 'active threat' and ordered shelter in place. Naval Security Forces and local law enforcement converged on Bancroft Hall and began clearing rooms. In one room, a midshipman who was sheltering in place mistook the responding officers for the rumored gunman and struck one with the butt of a parade rifle; officers shot the midshipman in the shoulder. He was medevaced by helicopter to the University of Maryland R Adams Cowley Shock Trauma Center, treated, and released the next day. The Navy confirmed at 9:40 p.m. that there was no active-shooter threat, and the lockdown was lifted shortly after midnight. Five days later, former midshipman Jackson Elliot 'Justin' Fleming, 23, of Chesterton, Indiana — recently dismissed from the Academy — was arrested and charged federally with making an interstate threat. The case is significant for the archive as the most consequential swatting incident at a US service academy in the modern era: a single anonymous post produced a lockdown of the entire Brigade of Midshipmen and an officer-involved shooting of a midshipman inside the country's most fortified federal dormitory.
Analysis

Key Findings

A single anonymous Yodel post produced a 7-hour lockdown of the entire 4,500-midshipman Brigade and an officer-involved shooting of a midshipman
The midshipman who was shot had been sheltering in place per the Academy's instructions when he struck a responding officer with a parade rifle, mistaking him for the gunman
The Academy's first public statement used the phrase 'security concern' rather than 'active shooter' — deliberately cautious until the threat was characterized
The Navy confirmed no active-shooter threat at 9:40 p.m. but kept shelter-in-place orders in effect for another 2+ hours while sweeps continued
Rep. Sarah Elfreth (D-MD) publicly called for a review of lockdown procedures, noting that 'we're living in a time when bomb threats to campuses are an almost everyday occurrence'
Former midshipman Justin Fleming was arrested 5 days later in Indiana and charged federally — a rare resolution for an anonymous campus threat
Outcome
No active shooter existed. The threat came from a Yodel post made by 23-year-old Jackson Elliot 'Justin' Fleming of Chesterton, Indiana — a former midshipman dismissed from the Academy who was confirmed in another state at the time of the post. He was arrested on September 16, 2025 and charged federally with making an interstate threat. During the sweep, a midshipman sheltering in his room mistook responding officers for the threat and struck one with a parade rifle; the midshipman was shot in the shoulder, evacuated by helicopter, treated, and released. The naval security officer suffered minor injuries.
Provenance

Sources

  1. Report
  2. News
  3. News
  4. News
  5. News
  6. News
  7. Official
  8. News
Tags
swattingservice-academymilitarynaval-academyannapolismarylandlockdownshelter-in-placebancroft-hallyodelanonymous-threatofficer-involved-shootingmidshipman-injuredfalse-reportHoax
Added May 2026Updated May 2026Via ingestion