Campus Alert Archive
VFMAC

The Sound That Locked Down a Military Academy Turned Out to Be Bubble Wrap

AI-generated · every claim is source-linked
PAlockdownemergency notificationmedium confidence
UnfoundedNo evidence of an actual threat was found. The institutional response is documented because the alert communication is identical to what would occur during a real incident.

On the evening of September 12, 2016, a resident at a nearby apartment complex reported hearing what she believed was gunfire near Valley Forge Military Academy and College in Wayne, Pennsylvania. Police responded with weapons drawn and locked down VFMAC along with neighboring Eastern University and Cabrini University while they searched for a shooter. After roughly 90 minutes, investigators concluded the sound was most likely bubble wrap being popped nearby; no shooter, victim, or weapon was ever found.

Alerts
2
Response
—
Killed
0
Injured
0
Institution
Valley Forge Military Academy and College
Military · PA
~600 students
Confirmed Timeline

Alert Sequence

2 messages in sequence

Some alert texts below are approximate reconstructions from news coverage, not confirmed verbatim transcripts. Reconstructed texts are shown in italic with a dashed border. Verified verbatim texts have a solid border and are marked accordingly.

INITIAL ALERTUnknown
Approximate reconstruction243 chars
Valley Forge Military Academy and College is currently on lockdown due to a report of gunshots in the vicinity of campus. All cadets and staff should shelter in place and remain in secure locations until further notice. Do not leave buildings.

This text has been reconstructed from news coverage and may not reflect the exact original wording.

The report originated from a resident of The Village, a set of Eastern University-operated apartments located on land adjacent to the VFMAC campus in Radnor Township, who called 911 believing she had heard gunfire
Three institutions -- Valley Forge Military Academy and College, Eastern University, and Cabrini University -- were placed on lockdown simultaneously because of their close physical proximity in Wayne, Pennsylvania
Officers responded with weapons drawn and searched buildings on foot for a suspected active shooter before determining no threat existed
ALL CLEARUnknown
Approximate reconstruction222 chars
The lockdown at Valley Forge Military Academy and College has been lifted. Law enforcement conducted a thorough search of the area and found no evidence of a shooter, weapon, or victim. Normal campus activities may resume.

This text has been reconstructed from news coverage and may not reflect the exact original wording.

Investigators ultimately attributed the sound to bubble wrap being popped in the vicinity, a conclusion that drew national attention for how an ordinary packaging material triggered a multi-agency active-shooter response
The roughly 90-minute lockdown illustrates how quickly an unverified single 911 call can cascade into a multi-campus emergency response in a densely packed suburban college corridor
Context

Background

Valley Forge Military Academy and College, known as "The Military College of Pennsylvania," sits in Wayne, Pennsylvania, in a corridor so tightly packed with small campuses that Eastern University leases student housing -- known as The Village -- on land adjoining VFMAC's own grounds. That proximity is what turned a single 911 call into a three-campus emergency on the evening of September 12, 2016. A resident of The Village told police she heard what sounded like gunshots, and officers responded to VFMAC, Eastern University, and neighboring Cabrini University with weapons drawn, searching buildings for an active shooter. After an intensive search turned up no shooter, victim, or weapon, investigators landed on an unlikely explanation: the popping of bubble wrap somewhere near the academy grounds. The case is a reminder that military academies, despite their armed-forces affiliation and campus security infrastructure, are not immune to the same false-alarm dynamics that have triggered active-shooter lockdowns across ordinary college campuses. Fox43's coverage noted the lockdown lasted roughly 90 minutes before all three schools resumed normal operations. VFMAC, a small private junior military college enrolling a combined total of around 600 cadets across its high school academy and two-year college, permanently closed after the 2025-2026 academic year.
Analysis

Key Findings

A single, unverified 911 call describing a sound 'like gunshots' triggered a simultaneous armed-response lockdown at three separate institutions -- Valley Forge Military Academy and College, Eastern University, and Cabrini University -- because of their close physical proximity in Wayne, Pennsylvania
The reported gunfire was ultimately attributed to bubble wrap being popped near campus, illustrating how ambiguous sounds can cascade into full active-shooter response protocols even at a military institution
The lockdown lasted approximately 90 minutes, from roughly 6:00 PM to 7:30 PM EDT on September 12, 2016, before normal operations resumed at all three schools
Outcome
No shooter, victim, or weapon was found. Police determined the reported gunfire was most likely the sound of bubble wrap being popped near the academy grounds.
Provenance

Sources

  1. Source
    A military academy was locked down after a report of gunshots. The likely culprit: Bubble wrap. - The Washington Post
    washingtonpost.com
    archived copy
  2. News
    Officials: Bubble wrap, not gunfire, at Valley Forge Military Academy - 6abc Philadelphia
    6abc.com
    archived copy
  3. News
    Lockdown at Valley Forge Military Academy over bubble wrap - Fox43
    fox43.com
    archived copy
Cite this case

Campus Alert Archive. "Valley Forge Military Academy and College: The Sound That Locked Down a Military Academy Turned Out to Be Bubble Wrap." Incident of September 12, 2016. Added July 2026. https://campusalertarchive.com/case/valley-forge-military-academy-bubble-wrap-lockdown-2016-09-12/

Download case JSON

Alert text quoted on this page remains the work of the issuing institution; the archive is a secondary source.

Tags
lockdownfalse-alarmmilitarypennsylvaniajunior-military-collegemulti-campusactive-shooter-hoax2016Unfounded
Added July 2026Updated July 2026Via ingestion