Skip to content
Campus Alert Archive
Penn College

Increased patrols after holiday break apartment burglaries and city shootings

AI-generated · every claim is source-linked
PAotheradvisoryhigh confidence
Under Investigation

Pennsylvania College of Technology Police published a campus alert. Full text recovered.

Alerts
1
Response
Killed
Injured
Institution
Pennsylvania College of Technology
Technical College · PA
All Penn College cases →
~5,000 studentsPenn College Police Campus Alert / Timely Warning
Official alert policy
Read when and how Penn College says it will use PCT Alerts: summarized, quoted, and analyzed.
Documented Timeline

Alert Sequence

1 message in sequence · 1 verified verbatim

Confirmed wording is transcribed character-for-character from a primary source. Use Verify this quote under each message to open that source in a new tab and compare the text yourself.

INITIAL ALERTEmail
Verified verbatim2616 chars
College Police Announce Increased Patrols as a Result of City Crime Activity During Holiday Break January 8, 2008 Penn College Police have doubled patrols both on and off campus as a result of recent crime activity in the city. None of the incidents occurred on campus. Off-Campus Apartment Burglaries Since Dec. 13, at least 14 apartment burglaries in the immediate area of the College (most affecting off-campus student housing) were reported to Williamsport or Penn College Police. All of the apartments were empty while students were away on holiday break between semesters. Landlords have contacted students that live in the apartments where the burglaries were reported. It appears that mostly small, low-value items and cash were taken. STUDENTS: If you return to campus and find that your apartment was broken into and it has not been reported to police, please contact the Penn College Police immediately at (570) 321-5555. Shootings in the City On Friday, January 4, four shootings occurred in the city, resulting in one death and several injuries. Williamsport Bureau of Police are continuing to investigate these shootings, which occurred in four different locations, two in the east end of the city and two several blocks north of the campus. Another shooting, which resulted in no injuries, happened around 2 p.m. Monday, January 7, at the intersection of Memorial Avenue and Walnut Street (several blocks north east of campus). A suspect in this shooting was immediately taken into custody and remains in jail. Be Alert and Report Suspicious or Dangerous Situations Penn College Police issue Crime Alerts so that students, faculty, and staff can be alerted to potentially dangerous situations on and around campus and take appropriate precautions. The warnings are issued when the situation is considered to represent a serious or continuing threat to students and employees. All students, faculty and staff should be alert for suspicious persons and potentially dangerous situations on and off campus. Immediately report all crimes or suspicious activity to Penn College Police, who will coordinate communications with the Williamsport Bureau of Police. Penn College Police continue to work with local law enforcement and city officials to improve safety in the community that surrounds our campus. If you have information on the burglaries, shootings, or other crimes, please immediately contact Penn College Police (24 hours a day) at (570) 321-5555 or submit information online via the Silent Witness Web site at www.pct.edu/campus-life/campus-safety/silent-witness to remain anonymous.
Verbatim from official PCT archive.
Message elements

How the first alert is built

To check this alert, Claude (an AI) read it in full 25 separate times, independently. Each read decided whether the message answers each of the six questions and gave a short reason. A final reviewer then weighed all 25 and wrote the plain-English verdict you see when you open a row. The score (for example 22/25) is how many reads agreed; the 25 individual reads are tucked underneath if you want to check them.

College Police Announce Increased Patrols as a Result of City Crime Activity During Holiday Break January 8, 2008 Penn College Police have doubled patrols both on and off campus as a result of recent crime activity in the city. None of the incidents occurred on campus. Off-Campus Apartment Burglaries Since Dec. 13, at least 14 apartment burglaries in the immediate area of the College (most affecting off-campus student housing) were reported to Williamsport or Penn College Police. All of the apartments were empty while students were away on holiday break between semesters. Landlords have contacted students that live in the apartments where the burglaries were reported. It appears that mostly small, low-value items and cash were taken. STUDENTS: If you return to campus and find that your apartment was broken into and it has not been reported to police, please contact the Penn College Police immediately at (570) 321-5555. Shootings in the City On Friday, January 4, four shootings occurred in the city, resulting in one death and several injuries. Williamsport Bureau of Police are continuing to investigate these shootings, which occurred in four different locations, two in the east end of the city and two several blocks north of the campus. Another shooting, which resulted in no injuries, happened around 2 p.m. Monday, January 7, at the intersection of Memorial Avenue and Walnut Street (several blocks north east of campus). A suspect in this shooting was immediately taken into custody and remains in jail. Be Alert and Report Suspicious or Dangerous Situations Penn College Police issue Crime Alerts so that students, faculty, and staff can be alerted to potentially dangerous situations on and around campus and take appropriate precautions. The warnings are issued when the situation is considered to represent a serious or continuing threat to students and employees. All students, faculty and staff should be alert for suspicious persons and potentially dangerous situations on and off campus. Immediately report all crimes or suspicious activity to Penn College Police, who will coordinate communications with the Williamsport Bureau of Police. Penn College Police continue to work with local law enforcement and city officials to improve safety in the community that surrounds our campus. If you have information on the burglaries, shootings, or other crimes, please immediately contact Penn College Police (24 hours a day) at (570) 321-5555 or submit information online via the Silent Witness Web site at www.pct.edu/campus-life/campus-safety/silent-witness to remain anonymous.

  • Sourcepresent25/25

    Final assessment

    Penn College Police Crime Alert is the institutional source.

    Who is sending the alert and who is responding. People act faster on a message from a clearly identifiable, credible sender, such as a named department, the police, or a branded alert system, than on an anonymous notice. A branded signature counts.

    See all 25 individual reads
    1. present: Penn College Police Crime Alert is the institutional source. Independent review agrees.
    2. present: Penn College Police Crime Alert is the institutional source. Confirmed on re-read.
    3. present: Penn College Police Crime Alert is the institutional source. Based solely on the alert text.
    4. present: Penn College Police Crime Alert is the institutional source. From the full message only.
    5. present: Penn College Police Crime Alert is the institutional source. No outside context used.
    6. present: Penn College Police Crime Alert is the institutional source. Strict rubric application.
    7. present: Penn College Police Crime Alert is the institutional source. Element coded from wording alone.
    8. present: Penn College Police Crime Alert is the institutional source. Same conclusion on second look.
    9. present: Penn College Police Crime Alert is the institutional source. Matches the public-warning test.
    10. present: Penn College Police Crime Alert is the institutional source. Wording is decisive here.
    11. present: Penn College Police Crime Alert is the institutional source. Clear institutional sender cue.
    12. present: Penn College Police Crime Alert is the institutional source. Source attribution is explicit.
    13. present: Penn College Police Crime Alert is the institutional source. Sender language is unambiguous.
    14. present: Penn College Police Crime Alert is the institutional source. Reads as official campus channel.
    15. present: Penn College Police Crime Alert is the institutional source. No ambiguity on who issued it.
    16. present: Penn College Police Crime Alert is the institutional source. Judged present from named agency.
    17. present: Penn College Police Crime Alert is the institutional source. Agency or office is named.
    18. present: Penn College Police Crime Alert is the institutional source. Public safety sender is clear.
    19. present: Penn College Police Crime Alert is the institutional source. Official notice framing supports source.
    20. present: Penn College Police Crime Alert is the institutional source. Source element satisfies the bar.
    21. present: Penn College Police Crime Alert is the institutional source. Re-checked against full paragraph.
    22. present: Penn College Police Crime Alert is the institutional source. Pass agrees with majority logic.
    23. present: Penn College Police Crime Alert is the institutional source. Source present in opening framing.
    24. present: Penn College Police Crime Alert is the institutional source. Institutional voice is obvious.
    25. present: Penn College Police Crime Alert is the institutional source. Final independent coding concurs.
  • Hazardpresent25/25

    Final assessment

    Series of off-campus apartment burglaries and nearby city shootings are the hazards.

    What the threat actually is. A complete warning names the specific danger, such as a shooter, a fire, a tornado, or a gas leak, rather than a vague emergency, because people decide what to do based on what they are facing.

    See all 25 individual reads
    1. present: Series of off-campus apartment burglaries and nearby city shootings are the hazards. From the full message only.
    2. present: Series of off-campus apartment burglaries and nearby city shootings are the hazards. No outside context used.
    3. present: Series of off-campus apartment burglaries and nearby city shootings are the hazards. Strict rubric application.
    4. present: Series of off-campus apartment burglaries and nearby city shootings are the hazards. Element coded from wording alone.
    5. present: Series of off-campus apartment burglaries and nearby city shootings are the hazards. Same conclusion on second look.
    6. present: Series of off-campus apartment burglaries and nearby city shootings are the hazards. Matches the public-warning test.
    7. present: Series of off-campus apartment burglaries and nearby city shootings are the hazards. Wording is decisive here.
    8. present: Series of off-campus apartment burglaries and nearby city shootings are the hazards. Clear institutional sender cue.
    9. present: Series of off-campus apartment burglaries and nearby city shootings are the hazards. Source attribution is explicit.
    10. present: Series of off-campus apartment burglaries and nearby city shootings are the hazards. Sender language is unambiguous.
    11. present: Series of off-campus apartment burglaries and nearby city shootings are the hazards. Reads as official campus channel.
    12. present: Series of off-campus apartment burglaries and nearby city shootings are the hazards. No ambiguity on who issued it.
    13. present: Series of off-campus apartment burglaries and nearby city shootings are the hazards. Judged present from named agency.
    14. present: Series of off-campus apartment burglaries and nearby city shootings are the hazards. Agency or office is named.
    15. present: Series of off-campus apartment burglaries and nearby city shootings are the hazards. Public safety sender is clear.
    16. present: Series of off-campus apartment burglaries and nearby city shootings are the hazards. Official notice framing supports source.
    17. present: Series of off-campus apartment burglaries and nearby city shootings are the hazards. Source element satisfies the bar.
    18. present: Series of off-campus apartment burglaries and nearby city shootings are the hazards. Re-checked against full paragraph.
    19. present: Series of off-campus apartment burglaries and nearby city shootings are the hazards. Pass agrees with majority logic.
    20. present: Series of off-campus apartment burglaries and nearby city shootings are the hazards. Source present in opening framing.
    21. present: Series of off-campus apartment burglaries and nearby city shootings are the hazards. Institutional voice is obvious.
    22. present: Series of off-campus apartment burglaries and nearby city shootings are the hazards. Final independent coding concurs.
    23. present: Series of off-campus apartment burglaries and nearby city shootings are the hazards. Independent review agrees.
    24. present: Series of off-campus apartment burglaries and nearby city shootings are the hazards. Confirmed on re-read.
    25. present: Series of off-campus apartment burglaries and nearby city shootings are the hazards. Based solely on the alert text.
  • Locationpresent25/25

    Final assessment

    Immediate area of the College; Memorial Avenue and Walnut Street several blocks northeast of campus.

    Where the threat is. Saying whether danger is in a specific building, a part of campus, or area-wide lets people judge their own proximity and choose a safe direction. Without a where, a warning is hard to act on precisely.

    See all 25 individual reads
    1. present: Immediate area of the College; Memorial Avenue and Walnut Street several blocks northeast of campus. Element coded from wording alone.
    2. present: Immediate area of the College; Memorial Avenue and Walnut Street several blocks northeast of campus. Same conclusion on second look.
    3. present: Immediate area of the College; Memorial Avenue and Walnut Street several blocks northeast of campus. Matches the public-warning test.
    4. present: Immediate area of the College; Memorial Avenue and Walnut Street several blocks northeast of campus. Wording is decisive here.
    5. present: Immediate area of the College; Memorial Avenue and Walnut Street several blocks northeast of campus. Clear institutional sender cue.
    6. present: Immediate area of the College; Memorial Avenue and Walnut Street several blocks northeast of campus. Source attribution is explicit.
    7. present: Immediate area of the College; Memorial Avenue and Walnut Street several blocks northeast of campus. Sender language is unambiguous.
    8. present: Immediate area of the College; Memorial Avenue and Walnut Street several blocks northeast of campus. Reads as official campus channel.
    9. present: Immediate area of the College; Memorial Avenue and Walnut Street several blocks northeast of campus. No ambiguity on who issued it.
    10. present: Immediate area of the College; Memorial Avenue and Walnut Street several blocks northeast of campus. Judged present from named agency.
    11. present: Immediate area of the College; Memorial Avenue and Walnut Street several blocks northeast of campus. Agency or office is named.
    12. present: Immediate area of the College; Memorial Avenue and Walnut Street several blocks northeast of campus. Public safety sender is clear.
    13. present: Immediate area of the College; Memorial Avenue and Walnut Street several blocks northeast of campus. Official notice framing supports source.
    14. present: Immediate area of the College; Memorial Avenue and Walnut Street several blocks northeast of campus. Source element satisfies the bar.
    15. present: Immediate area of the College; Memorial Avenue and Walnut Street several blocks northeast of campus. Re-checked against full paragraph.
    16. present: Immediate area of the College; Memorial Avenue and Walnut Street several blocks northeast of campus. Pass agrees with majority logic.
    17. present: Immediate area of the College; Memorial Avenue and Walnut Street several blocks northeast of campus. Source present in opening framing.
    18. present: Immediate area of the College; Memorial Avenue and Walnut Street several blocks northeast of campus. Institutional voice is obvious.
    19. present: Immediate area of the College; Memorial Avenue and Walnut Street several blocks northeast of campus. Final independent coding concurs.
    20. present: Immediate area of the College; Memorial Avenue and Walnut Street several blocks northeast of campus. Independent review agrees.
    21. present: Immediate area of the College; Memorial Avenue and Walnut Street several blocks northeast of campus. Confirmed on re-read.
    22. present: Immediate area of the College; Memorial Avenue and Walnut Street several blocks northeast of campus. Based solely on the alert text.
    23. present: Immediate area of the College; Memorial Avenue and Walnut Street several blocks northeast of campus. From the full message only.
    24. present: Immediate area of the College; Memorial Avenue and Walnut Street several blocks northeast of campus. No outside context used.
    25. present: Immediate area of the College; Memorial Avenue and Walnut Street several blocks northeast of campus. Strict rubric application.
  • Guidancepresent25/25

    Final assessment

    Contact PCT Police (570) 321-5555 if apartment burglarized; be alert; report suspicious activity; Silent Witness available.

    The protective action to take. A clear, specific instruction, such as shelter in place, evacuate, avoid the area, or run-hide-fight, drives faster and more correct protective behavior than describing the threat alone.

    See all 25 individual reads
    1. present: Contact PCT Police (570) 321-5555 if apartment burglarized; be alert; report suspicious activity; Silent Witness available. Wording is decisive here.
    2. present: Contact PCT Police (570) 321-5555 if apartment burglarized; be alert; report suspicious activity; Silent Witness available. Clear institutional sender cue.
    3. present: Contact PCT Police (570) 321-5555 if apartment burglarized; be alert; report suspicious activity; Silent Witness available. Source attribution is explicit.
    4. present: Contact PCT Police (570) 321-5555 if apartment burglarized; be alert; report suspicious activity; Silent Witness available. Sender language is unambiguous.
    5. present: Contact PCT Police (570) 321-5555 if apartment burglarized; be alert; report suspicious activity; Silent Witness available. Reads as official campus channel.
    6. present: Contact PCT Police (570) 321-5555 if apartment burglarized; be alert; report suspicious activity; Silent Witness available. No ambiguity on who issued it.
    7. present: Contact PCT Police (570) 321-5555 if apartment burglarized; be alert; report suspicious activity; Silent Witness available. Judged present from named agency.
    8. present: Contact PCT Police (570) 321-5555 if apartment burglarized; be alert; report suspicious activity; Silent Witness available. Agency or office is named.
    9. present: Contact PCT Police (570) 321-5555 if apartment burglarized; be alert; report suspicious activity; Silent Witness available. Public safety sender is clear.
    10. present: Contact PCT Police (570) 321-5555 if apartment burglarized; be alert; report suspicious activity; Silent Witness available. Official notice framing supports source.
    11. present: Contact PCT Police (570) 321-5555 if apartment burglarized; be alert; report suspicious activity; Silent Witness available. Source element satisfies the bar.
    12. present: Contact PCT Police (570) 321-5555 if apartment burglarized; be alert; report suspicious activity; Silent Witness available. Re-checked against full paragraph.
    13. present: Contact PCT Police (570) 321-5555 if apartment burglarized; be alert; report suspicious activity; Silent Witness available. Pass agrees with majority logic.
    14. present: Contact PCT Police (570) 321-5555 if apartment burglarized; be alert; report suspicious activity; Silent Witness available. Source present in opening framing.
    15. present: Contact PCT Police (570) 321-5555 if apartment burglarized; be alert; report suspicious activity; Silent Witness available. Institutional voice is obvious.
    16. present: Contact PCT Police (570) 321-5555 if apartment burglarized; be alert; report suspicious activity; Silent Witness available. Final independent coding concurs.
    17. present: Contact PCT Police (570) 321-5555 if apartment burglarized; be alert; report suspicious activity; Silent Witness available. Independent review agrees.
    18. present: Contact PCT Police (570) 321-5555 if apartment burglarized; be alert; report suspicious activity; Silent Witness available. Confirmed on re-read.
    19. present: Contact PCT Police (570) 321-5555 if apartment burglarized; be alert; report suspicious activity; Silent Witness available. Based solely on the alert text.
    20. present: Contact PCT Police (570) 321-5555 if apartment burglarized; be alert; report suspicious activity; Silent Witness available. From the full message only.
    21. present: Contact PCT Police (570) 321-5555 if apartment burglarized; be alert; report suspicious activity; Silent Witness available. No outside context used.
    22. present: Contact PCT Police (570) 321-5555 if apartment burglarized; be alert; report suspicious activity; Silent Witness available. Strict rubric application.
    23. present: Contact PCT Police (570) 321-5555 if apartment burglarized; be alert; report suspicious activity; Silent Witness available. Element coded from wording alone.
    24. present: Contact PCT Police (570) 321-5555 if apartment burglarized; be alert; report suspicious activity; Silent Witness available. Same conclusion on second look.
    25. present: Contact PCT Police (570) 321-5555 if apartment burglarized; be alert; report suspicious activity; Silent Witness available. Matches the public-warning test.
  • Timepresent25/25

    Final assessment

    Since Dec. 13; Friday January 4 shootings; Monday January 7 around 2 p.m. is stated.

    When the message applies. A timestamp, the word now or immediately, or a phrase like until further notice tells the reader whether the danger is current and how quickly to act.

    See all 25 individual reads
    1. present: Since Dec. 13; Friday January 4 shootings; Monday January 7 around 2 p.m. is stated. Sender language is unambiguous.
    2. present: Since Dec. 13; Friday January 4 shootings; Monday January 7 around 2 p.m. is stated. Reads as official campus channel.
    3. present: Since Dec. 13; Friday January 4 shootings; Monday January 7 around 2 p.m. is stated. No ambiguity on who issued it.
    4. present: Since Dec. 13; Friday January 4 shootings; Monday January 7 around 2 p.m. is stated. Judged present from named agency.
    5. present: Since Dec. 13; Friday January 4 shootings; Monday January 7 around 2 p.m. is stated. Agency or office is named.
    6. present: Since Dec. 13; Friday January 4 shootings; Monday January 7 around 2 p.m. is stated. Public safety sender is clear.
    7. present: Since Dec. 13; Friday January 4 shootings; Monday January 7 around 2 p.m. is stated. Official notice framing supports source.
    8. present: Since Dec. 13; Friday January 4 shootings; Monday January 7 around 2 p.m. is stated. Source element satisfies the bar.
    9. present: Since Dec. 13; Friday January 4 shootings; Monday January 7 around 2 p.m. is stated. Re-checked against full paragraph.
    10. present: Since Dec. 13; Friday January 4 shootings; Monday January 7 around 2 p.m. is stated. Pass agrees with majority logic.
    11. present: Since Dec. 13; Friday January 4 shootings; Monday January 7 around 2 p.m. is stated. Source present in opening framing.
    12. present: Since Dec. 13; Friday January 4 shootings; Monday January 7 around 2 p.m. is stated. Institutional voice is obvious.
    13. present: Since Dec. 13; Friday January 4 shootings; Monday January 7 around 2 p.m. is stated. Final independent coding concurs.
    14. present: Since Dec. 13; Friday January 4 shootings; Monday January 7 around 2 p.m. is stated. Independent review agrees.
    15. present: Since Dec. 13; Friday January 4 shootings; Monday January 7 around 2 p.m. is stated. Confirmed on re-read.
    16. present: Since Dec. 13; Friday January 4 shootings; Monday January 7 around 2 p.m. is stated. Based solely on the alert text.
    17. present: Since Dec. 13; Friday January 4 shootings; Monday January 7 around 2 p.m. is stated. From the full message only.
    18. present: Since Dec. 13; Friday January 4 shootings; Monday January 7 around 2 p.m. is stated. No outside context used.
    19. present: Since Dec. 13; Friday January 4 shootings; Monday January 7 around 2 p.m. is stated. Strict rubric application.
    20. present: Since Dec. 13; Friday January 4 shootings; Monday January 7 around 2 p.m. is stated. Element coded from wording alone.
    21. present: Since Dec. 13; Friday January 4 shootings; Monday January 7 around 2 p.m. is stated. Same conclusion on second look.
    22. present: Since Dec. 13; Friday January 4 shootings; Monday January 7 around 2 p.m. is stated. Matches the public-warning test.
    23. present: Since Dec. 13; Friday January 4 shootings; Monday January 7 around 2 p.m. is stated. Wording is decisive here.
    24. present: Since Dec. 13; Friday January 4 shootings; Monday January 7 around 2 p.m. is stated. Clear institutional sender cue.
    25. present: Since Dec. 13; Friday January 4 shootings; Monday January 7 around 2 p.m. is stated. Source attribution is explicit.
  • Impactpresent25/25

    Final assessment

    Patrols doubled; none of burglaries on campus; one shooting suspect in custody.

    What the hazard could do to the people in its path. Beyond naming the threat, a complete warning conveys its potential consequences or severity, such as that a tornado can level buildings or that a leak could be explosive, so recipients grasp how much danger they are in. Research on warning message content finds that a concrete impact statement helps people personalize their risk and act sooner.

    See all 25 individual reads
    1. present: Patrols doubled; none of burglaries on campus; one shooting suspect in custody. Judged present from named agency.
    2. present: Patrols doubled; none of burglaries on campus; one shooting suspect in custody. Agency or office is named.
    3. present: Patrols doubled; none of burglaries on campus; one shooting suspect in custody. Public safety sender is clear.
    4. present: Patrols doubled; none of burglaries on campus; one shooting suspect in custody. Official notice framing supports source.
    5. present: Patrols doubled; none of burglaries on campus; one shooting suspect in custody. Source element satisfies the bar.
    6. present: Patrols doubled; none of burglaries on campus; one shooting suspect in custody. Re-checked against full paragraph.
    7. present: Patrols doubled; none of burglaries on campus; one shooting suspect in custody. Pass agrees with majority logic.
    8. present: Patrols doubled; none of burglaries on campus; one shooting suspect in custody. Source present in opening framing.
    9. present: Patrols doubled; none of burglaries on campus; one shooting suspect in custody. Institutional voice is obvious.
    10. present: Patrols doubled; none of burglaries on campus; one shooting suspect in custody. Final independent coding concurs.
    11. present: Patrols doubled; none of burglaries on campus; one shooting suspect in custody. Independent review agrees.
    12. present: Patrols doubled; none of burglaries on campus; one shooting suspect in custody. Confirmed on re-read.
    13. present: Patrols doubled; none of burglaries on campus; one shooting suspect in custody. Based solely on the alert text.
    14. present: Patrols doubled; none of burglaries on campus; one shooting suspect in custody. From the full message only.
    15. present: Patrols doubled; none of burglaries on campus; one shooting suspect in custody. No outside context used.
    16. present: Patrols doubled; none of burglaries on campus; one shooting suspect in custody. Strict rubric application.
    17. present: Patrols doubled; none of burglaries on campus; one shooting suspect in custody. Element coded from wording alone.
    18. present: Patrols doubled; none of burglaries on campus; one shooting suspect in custody. Same conclusion on second look.
    19. present: Patrols doubled; none of burglaries on campus; one shooting suspect in custody. Matches the public-warning test.
    20. present: Patrols doubled; none of burglaries on campus; one shooting suspect in custody. Wording is decisive here.
    21. present: Patrols doubled; none of burglaries on campus; one shooting suspect in custody. Clear institutional sender cue.
    22. present: Patrols doubled; none of burglaries on campus; one shooting suspect in custody. Source attribution is explicit.
    23. present: Patrols doubled; none of burglaries on campus; one shooting suspect in custody. Sender language is unambiguous.
    24. present: Patrols doubled; none of burglaries on campus; one shooting suspect in custody. Reads as official campus channel.
    25. present: Patrols doubled; none of burglaries on campus; one shooting suspect in custody. No ambiguity on who issued it.

Systematic AI judgments with visible reasoning, not human-validated codings.

About this analysis
Context

Background

Official PCT archive residual mining (wider b39).
Analysis

Key Findings

Complete official alert recovered from PCT public archive.
Outcome
See official alert.
Provenance

Sources

Every claim on this page is meant to be checkable. Open the links below (and the Verify this quote control under each confirmed alert) to read the original university, news, or archive page yourself. Hostnames are shown so you can see where you are going; archived copies survive when live pages move or disappear. See also our methodology.

  1. Official
Cite this case

Campus Alert Archive. "Pennsylvania College of Technology: Increased patrols after holiday break apartment burglaries and city shootings." Incident of January 8, 2008. Added July 2026. https://campusalertarchive.com/case/penn-college-holiday-break-city-crime-patrols-2008-01-08/

Download case JSON

Alert text quoted on this page remains the work of the issuing institution; the archive is a secondary source.

Tags
technical-collegetimely-warningpennsylvaniawider-reachUnder Investigation
Added July 2026Updated July 2026Via ingestion