Skip to content
Campus Alert Archive
Penn College

Attempted robbery on campus mall toward West Third Street

AI-generated · every claim is source-linked
PArobberytimely warninghigh confidence
Under Investigation

Pennsylvania College of Technology Police published a campus alert. Full text recovered.

Alerts
1
Response
Killed
Injured
Institution
Pennsylvania College of Technology
Technical College · PA
All Penn College cases →
~5,000 studentsPenn College Police Campus Alert / Timely Warning
Official alert policy
Read when and how Penn College says it will use PCT Alerts: summarized, quoted, and analyzed.
Documented Timeline

Alert Sequence

1 message in sequence · 1 verified verbatim

Confirmed wording is transcribed character-for-character from a primary source. Use Verify this quote under each message to open that source in a new tab and compare the text yourself.

INITIAL ALERTEmail
Verified verbatim968 chars
Student Reports Attempted Robbery December 3, 2010 A Pennsylvania College of Technology student reported that two suspects attempted to rob him about 8:30 p.m. Thursday as he walked north on the mall toward West Third Street after exiting the Keystone Dining Room. The student was not injured. The student reported the incident to Penn College Police at 1 a.m. today. He said he was grabbed from behind by two black males. One of the suspects is described as 6 feet tall, wearing a black "puffy" coat with a gray hood and jeans. The second male is described as 6 feet tall, wearing a dark-colored winter coat, a black beanie cap and jeans. The second male displayed a handgun but did not point it at the student as he asked for money. Penn College Police are asking anyone who was in the vicinity of the incident at 8:30 p.m. Thursday to contact them at 570-321-5555. Police also remind that anyone who is a victim of a crime should report it to police immediately.
Verbatim from official PCT archive.
Message elements

How the first alert is built

To check this alert, Claude (an AI) read it in full 25 separate times, independently. Each read decided whether the message answers each of the six questions and gave a short reason. A final reviewer then weighed all 25 and wrote the plain-English verdict you see when you open a row. The score (for example 22/25) is how many reads agreed; the 25 individual reads are tucked underneath if you want to check them.

Student Reports Attempted Robbery December 3, 2010 A Pennsylvania College of Technology student reported that two suspects attempted to rob him about 8:30 p.m. Thursday as he walked north on the mall toward West Third Street after exiting the Keystone Dining Room. The student was not injured. The student reported the incident to Penn College Police at 1 a.m. today. He said he was grabbed from behind by two black males. One of the suspects is described as 6 feet tall, wearing a black "puffy" coat with a gray hood and jeans. The second male is described as 6 feet tall, wearing a dark-colored winter coat, a black beanie cap and jeans. The second male displayed a handgun but did not point it at the student as he asked for money. Penn College Police are asking anyone who was in the vicinity of the incident at 8:30 p.m. Thursday to contact them at 570-321-5555. Police also remind that anyone who is a victim of a crime should report it to police immediately.

  • Sourcepresent25/25

    Final assessment

    Penn College Police attempted robbery alert is the source.

    Who is sending the alert and who is responding. People act faster on a message from a clearly identifiable, credible sender, such as a named department, the police, or a branded alert system, than on an anonymous notice. A branded signature counts.

    See all 25 individual reads
    1. present: Penn College Police attempted robbery alert is the source. Independent review agrees.
    2. present: Penn College Police attempted robbery alert is the source. Confirmed on re-read.
    3. present: Penn College Police attempted robbery alert is the source. Based solely on the alert text.
    4. present: Penn College Police attempted robbery alert is the source. From the full message only.
    5. present: Penn College Police attempted robbery alert is the source. No outside context used.
    6. present: Penn College Police attempted robbery alert is the source. Strict rubric application.
    7. present: Penn College Police attempted robbery alert is the source. Element coded from wording alone.
    8. present: Penn College Police attempted robbery alert is the source. Same conclusion on second look.
    9. present: Penn College Police attempted robbery alert is the source. Matches the public-warning test.
    10. present: Penn College Police attempted robbery alert is the source. Wording is decisive here.
    11. present: Penn College Police attempted robbery alert is the source. Clear institutional sender cue.
    12. present: Penn College Police attempted robbery alert is the source. Source attribution is explicit.
    13. present: Penn College Police attempted robbery alert is the source. Sender language is unambiguous.
    14. present: Penn College Police attempted robbery alert is the source. Reads as official campus channel.
    15. present: Penn College Police attempted robbery alert is the source. No ambiguity on who issued it.
    16. present: Penn College Police attempted robbery alert is the source. Judged present from named agency.
    17. present: Penn College Police attempted robbery alert is the source. Agency or office is named.
    18. present: Penn College Police attempted robbery alert is the source. Public safety sender is clear.
    19. present: Penn College Police attempted robbery alert is the source. Official notice framing supports source.
    20. present: Penn College Police attempted robbery alert is the source. Source element satisfies the bar.
    21. present: Penn College Police attempted robbery alert is the source. Re-checked against full paragraph.
    22. present: Penn College Police attempted robbery alert is the source. Pass agrees with majority logic.
    23. present: Penn College Police attempted robbery alert is the source. Source present in opening framing.
    24. present: Penn College Police attempted robbery alert is the source. Institutional voice is obvious.
    25. present: Penn College Police attempted robbery alert is the source. Final independent coding concurs.
  • Hazardpresent25/25

    Final assessment

    Attempted robbery with displayed handgun is the hazard.

    What the threat actually is. A complete warning names the specific danger, such as a shooter, a fire, a tornado, or a gas leak, rather than a vague emergency, because people decide what to do based on what they are facing.

    See all 25 individual reads
    1. present: Attempted robbery with displayed handgun is the hazard. From the full message only.
    2. present: Attempted robbery with displayed handgun is the hazard. No outside context used.
    3. present: Attempted robbery with displayed handgun is the hazard. Strict rubric application.
    4. present: Attempted robbery with displayed handgun is the hazard. Element coded from wording alone.
    5. present: Attempted robbery with displayed handgun is the hazard. Same conclusion on second look.
    6. present: Attempted robbery with displayed handgun is the hazard. Matches the public-warning test.
    7. present: Attempted robbery with displayed handgun is the hazard. Wording is decisive here.
    8. present: Attempted robbery with displayed handgun is the hazard. Clear institutional sender cue.
    9. present: Attempted robbery with displayed handgun is the hazard. Source attribution is explicit.
    10. present: Attempted robbery with displayed handgun is the hazard. Sender language is unambiguous.
    11. present: Attempted robbery with displayed handgun is the hazard. Reads as official campus channel.
    12. present: Attempted robbery with displayed handgun is the hazard. No ambiguity on who issued it.
    13. present: Attempted robbery with displayed handgun is the hazard. Judged present from named agency.
    14. present: Attempted robbery with displayed handgun is the hazard. Agency or office is named.
    15. present: Attempted robbery with displayed handgun is the hazard. Public safety sender is clear.
    16. present: Attempted robbery with displayed handgun is the hazard. Official notice framing supports source.
    17. present: Attempted robbery with displayed handgun is the hazard. Source element satisfies the bar.
    18. present: Attempted robbery with displayed handgun is the hazard. Re-checked against full paragraph.
    19. present: Attempted robbery with displayed handgun is the hazard. Pass agrees with majority logic.
    20. present: Attempted robbery with displayed handgun is the hazard. Source present in opening framing.
    21. present: Attempted robbery with displayed handgun is the hazard. Institutional voice is obvious.
    22. present: Attempted robbery with displayed handgun is the hazard. Final independent coding concurs.
    23. present: Attempted robbery with displayed handgun is the hazard. Independent review agrees.
    24. present: Attempted robbery with displayed handgun is the hazard. Confirmed on re-read.
    25. present: Attempted robbery with displayed handgun is the hazard. Based solely on the alert text.
  • Locationpresent25/25

    Final assessment

    Campus mall toward West Third Street after Keystone Dining Room is named.

    Where the threat is. Saying whether danger is in a specific building, a part of campus, or area-wide lets people judge their own proximity and choose a safe direction. Without a where, a warning is hard to act on precisely.

    See all 25 individual reads
    1. present: Campus mall toward West Third Street after Keystone Dining Room is named. Element coded from wording alone.
    2. present: Campus mall toward West Third Street after Keystone Dining Room is named. Same conclusion on second look.
    3. present: Campus mall toward West Third Street after Keystone Dining Room is named. Matches the public-warning test.
    4. present: Campus mall toward West Third Street after Keystone Dining Room is named. Wording is decisive here.
    5. present: Campus mall toward West Third Street after Keystone Dining Room is named. Clear institutional sender cue.
    6. present: Campus mall toward West Third Street after Keystone Dining Room is named. Source attribution is explicit.
    7. present: Campus mall toward West Third Street after Keystone Dining Room is named. Sender language is unambiguous.
    8. present: Campus mall toward West Third Street after Keystone Dining Room is named. Reads as official campus channel.
    9. present: Campus mall toward West Third Street after Keystone Dining Room is named. No ambiguity on who issued it.
    10. present: Campus mall toward West Third Street after Keystone Dining Room is named. Judged present from named agency.
    11. present: Campus mall toward West Third Street after Keystone Dining Room is named. Agency or office is named.
    12. present: Campus mall toward West Third Street after Keystone Dining Room is named. Public safety sender is clear.
    13. present: Campus mall toward West Third Street after Keystone Dining Room is named. Official notice framing supports source.
    14. present: Campus mall toward West Third Street after Keystone Dining Room is named. Source element satisfies the bar.
    15. present: Campus mall toward West Third Street after Keystone Dining Room is named. Re-checked against full paragraph.
    16. present: Campus mall toward West Third Street after Keystone Dining Room is named. Pass agrees with majority logic.
    17. present: Campus mall toward West Third Street after Keystone Dining Room is named. Source present in opening framing.
    18. present: Campus mall toward West Third Street after Keystone Dining Room is named. Institutional voice is obvious.
    19. present: Campus mall toward West Third Street after Keystone Dining Room is named. Final independent coding concurs.
    20. present: Campus mall toward West Third Street after Keystone Dining Room is named. Independent review agrees.
    21. present: Campus mall toward West Third Street after Keystone Dining Room is named. Confirmed on re-read.
    22. present: Campus mall toward West Third Street after Keystone Dining Room is named. Based solely on the alert text.
    23. present: Campus mall toward West Third Street after Keystone Dining Room is named. From the full message only.
    24. present: Campus mall toward West Third Street after Keystone Dining Room is named. No outside context used.
    25. present: Campus mall toward West Third Street after Keystone Dining Room is named. Strict rubric application.
  • Guidancepresent25/25

    Final assessment

    Contact Penn College Police at 570-321-5555.

    The protective action to take. A clear, specific instruction, such as shelter in place, evacuate, avoid the area, or run-hide-fight, drives faster and more correct protective behavior than describing the threat alone.

    See all 25 individual reads
    1. present: Contact Penn College Police at 570-321-5555. Wording is decisive here.
    2. present: Contact Penn College Police at 570-321-5555. Clear institutional sender cue.
    3. present: Contact Penn College Police at 570-321-5555. Source attribution is explicit.
    4. present: Contact Penn College Police at 570-321-5555. Sender language is unambiguous.
    5. present: Contact Penn College Police at 570-321-5555. Reads as official campus channel.
    6. present: Contact Penn College Police at 570-321-5555. No ambiguity on who issued it.
    7. present: Contact Penn College Police at 570-321-5555. Judged present from named agency.
    8. present: Contact Penn College Police at 570-321-5555. Agency or office is named.
    9. present: Contact Penn College Police at 570-321-5555. Public safety sender is clear.
    10. present: Contact Penn College Police at 570-321-5555. Official notice framing supports source.
    11. present: Contact Penn College Police at 570-321-5555. Source element satisfies the bar.
    12. present: Contact Penn College Police at 570-321-5555. Re-checked against full paragraph.
    13. present: Contact Penn College Police at 570-321-5555. Pass agrees with majority logic.
    14. present: Contact Penn College Police at 570-321-5555. Source present in opening framing.
    15. present: Contact Penn College Police at 570-321-5555. Institutional voice is obvious.
    16. present: Contact Penn College Police at 570-321-5555. Final independent coding concurs.
    17. present: Contact Penn College Police at 570-321-5555. Independent review agrees.
    18. present: Contact Penn College Police at 570-321-5555. Confirmed on re-read.
    19. present: Contact Penn College Police at 570-321-5555. Based solely on the alert text.
    20. present: Contact Penn College Police at 570-321-5555. From the full message only.
    21. present: Contact Penn College Police at 570-321-5555. No outside context used.
    22. present: Contact Penn College Police at 570-321-5555. Strict rubric application.
    23. present: Contact Penn College Police at 570-321-5555. Element coded from wording alone.
    24. present: Contact Penn College Police at 570-321-5555. Same conclusion on second look.
    25. present: Contact Penn College Police at 570-321-5555. Matches the public-warning test.
  • Timepresent25/25

    Final assessment

    About 8:30 p.m. Thursday; reported 1 a.m.; December 3 2010 notice.

    When the message applies. A timestamp, the word now or immediately, or a phrase like until further notice tells the reader whether the danger is current and how quickly to act.

    See all 25 individual reads
    1. present: About 8:30 p.m. Thursday; reported 1 a.m.; December 3 2010 notice. Sender language is unambiguous.
    2. present: About 8:30 p.m. Thursday; reported 1 a.m.; December 3 2010 notice. Reads as official campus channel.
    3. present: About 8:30 p.m. Thursday; reported 1 a.m.; December 3 2010 notice. No ambiguity on who issued it.
    4. present: About 8:30 p.m. Thursday; reported 1 a.m.; December 3 2010 notice. Judged present from named agency.
    5. present: About 8:30 p.m. Thursday; reported 1 a.m.; December 3 2010 notice. Agency or office is named.
    6. present: About 8:30 p.m. Thursday; reported 1 a.m.; December 3 2010 notice. Public safety sender is clear.
    7. present: About 8:30 p.m. Thursday; reported 1 a.m.; December 3 2010 notice. Official notice framing supports source.
    8. present: About 8:30 p.m. Thursday; reported 1 a.m.; December 3 2010 notice. Source element satisfies the bar.
    9. present: About 8:30 p.m. Thursday; reported 1 a.m.; December 3 2010 notice. Re-checked against full paragraph.
    10. present: About 8:30 p.m. Thursday; reported 1 a.m.; December 3 2010 notice. Pass agrees with majority logic.
    11. present: About 8:30 p.m. Thursday; reported 1 a.m.; December 3 2010 notice. Source present in opening framing.
    12. present: About 8:30 p.m. Thursday; reported 1 a.m.; December 3 2010 notice. Institutional voice is obvious.
    13. present: About 8:30 p.m. Thursday; reported 1 a.m.; December 3 2010 notice. Final independent coding concurs.
    14. present: About 8:30 p.m. Thursday; reported 1 a.m.; December 3 2010 notice. Independent review agrees.
    15. present: About 8:30 p.m. Thursday; reported 1 a.m.; December 3 2010 notice. Confirmed on re-read.
    16. present: About 8:30 p.m. Thursday; reported 1 a.m.; December 3 2010 notice. Based solely on the alert text.
    17. present: About 8:30 p.m. Thursday; reported 1 a.m.; December 3 2010 notice. From the full message only.
    18. present: About 8:30 p.m. Thursday; reported 1 a.m.; December 3 2010 notice. No outside context used.
    19. present: About 8:30 p.m. Thursday; reported 1 a.m.; December 3 2010 notice. Strict rubric application.
    20. present: About 8:30 p.m. Thursday; reported 1 a.m.; December 3 2010 notice. Element coded from wording alone.
    21. present: About 8:30 p.m. Thursday; reported 1 a.m.; December 3 2010 notice. Same conclusion on second look.
    22. present: About 8:30 p.m. Thursday; reported 1 a.m.; December 3 2010 notice. Matches the public-warning test.
    23. present: About 8:30 p.m. Thursday; reported 1 a.m.; December 3 2010 notice. Wording is decisive here.
    24. present: About 8:30 p.m. Thursday; reported 1 a.m.; December 3 2010 notice. Clear institutional sender cue.
    25. present: About 8:30 p.m. Thursday; reported 1 a.m.; December 3 2010 notice. Source attribution is explicit.
  • Impactpresent25/25

    Final assessment

    Student not injured; second male displayed handgun while asking for money.

    What the hazard could do to the people in its path. Beyond naming the threat, a complete warning conveys its potential consequences or severity, such as that a tornado can level buildings or that a leak could be explosive, so recipients grasp how much danger they are in. Research on warning message content finds that a concrete impact statement helps people personalize their risk and act sooner.

    See all 25 individual reads
    1. present: Student not injured; second male displayed handgun while asking for money. Judged present from named agency.
    2. present: Student not injured; second male displayed handgun while asking for money. Agency or office is named.
    3. present: Student not injured; second male displayed handgun while asking for money. Public safety sender is clear.
    4. present: Student not injured; second male displayed handgun while asking for money. Official notice framing supports source.
    5. present: Student not injured; second male displayed handgun while asking for money. Source element satisfies the bar.
    6. present: Student not injured; second male displayed handgun while asking for money. Re-checked against full paragraph.
    7. present: Student not injured; second male displayed handgun while asking for money. Pass agrees with majority logic.
    8. present: Student not injured; second male displayed handgun while asking for money. Source present in opening framing.
    9. present: Student not injured; second male displayed handgun while asking for money. Institutional voice is obvious.
    10. present: Student not injured; second male displayed handgun while asking for money. Final independent coding concurs.
    11. present: Student not injured; second male displayed handgun while asking for money. Independent review agrees.
    12. present: Student not injured; second male displayed handgun while asking for money. Confirmed on re-read.
    13. present: Student not injured; second male displayed handgun while asking for money. Based solely on the alert text.
    14. present: Student not injured; second male displayed handgun while asking for money. From the full message only.
    15. present: Student not injured; second male displayed handgun while asking for money. No outside context used.
    16. present: Student not injured; second male displayed handgun while asking for money. Strict rubric application.
    17. present: Student not injured; second male displayed handgun while asking for money. Element coded from wording alone.
    18. present: Student not injured; second male displayed handgun while asking for money. Same conclusion on second look.
    19. present: Student not injured; second male displayed handgun while asking for money. Matches the public-warning test.
    20. present: Student not injured; second male displayed handgun while asking for money. Wording is decisive here.
    21. present: Student not injured; second male displayed handgun while asking for money. Clear institutional sender cue.
    22. present: Student not injured; second male displayed handgun while asking for money. Source attribution is explicit.
    23. present: Student not injured; second male displayed handgun while asking for money. Sender language is unambiguous.
    24. present: Student not injured; second male displayed handgun while asking for money. Reads as official campus channel.
    25. present: Student not injured; second male displayed handgun while asking for money. No ambiguity on who issued it.

Systematic AI judgments with visible reasoning, not human-validated codings.

About this analysis
Context

Background

Official PCT archive.
Analysis

Key Findings

Complete official alert recovered.
Outcome
See official alert.
Provenance

Sources

Every claim on this page is meant to be checkable. Open the links below (and the Verify this quote control under each confirmed alert) to read the original university, news, or archive page yourself. Hostnames are shown so you can see where you are going; archived copies survive when live pages move or disappear. See also our methodology.

  1. Official
Cite this case

Campus Alert Archive. "Pennsylvania College of Technology: Attempted robbery on campus mall toward West Third Street." Incident of December 3, 2010. Added July 2026. https://campusalertarchive.com/case/penn-college-mall-attempted-robbery-2010-12-03/

Download case JSON

Alert text quoted on this page remains the work of the issuing institution; the archive is a secondary source.

Tags
technical-collegetimely-warningpennsylvaniaUnder Investigation
Added July 2026Updated July 2026Via ingestion