Skip to content
Campus Alert Archive
Penn College

Assault and robbery Thompson Professional Development Center parking lot

AI-generated · every claim is source-linked
PArobberytimely warninghigh confidence
Under Investigation

Pennsylvania College of Technology Police published a campus alert. Full text recovered.

Alerts
1
Response
Killed
Injured
Institution
Pennsylvania College of Technology
Technical College · PA
All Penn College cases →
~5,000 studentsPenn College Police Campus Alert / Timely Warning
Official alert policy
Read when and how Penn College says it will use PCT Alerts: summarized, quoted, and analyzed.
Documented Timeline

Alert Sequence

1 message in sequence · 1 verified verbatim

Confirmed wording is transcribed character-for-character from a primary source. Use Verify this quote under each message to open that source in a new tab and compare the text yourself.

INITIAL ALERTEmail
Verified verbatim649 chars
Student Reports Being Assaulted and Robbed November 21, 2010 The incident occurred at 1 a.m. in the parking lot outside the Thompson Professional Development Center. The student said he was approached by someone described as a light-skinned black male, wearing a red, hooded sweat shirt and blue jeans, who was accompanied by two other black males. The student said he was jumped from behind, struck in the face and pulled to the ground by the assailants. The suspects took a small amount of money from the student and fled the area in an unknown direction. Anyone with additional information is urged to call Penn College Police at 570-321-5555.
Verbatim from official PCT archive.
Message elements

How the first alert is built

To check this alert, Claude (an AI) read it in full 25 separate times, independently. Each read decided whether the message answers each of the six questions and gave a short reason. A final reviewer then weighed all 25 and wrote the plain-English verdict you see when you open a row. The score (for example 22/25) is how many reads agreed; the 25 individual reads are tucked underneath if you want to check them.

Student Reports Being Assaulted and Robbed November 21, 2010 The incident occurred at 1 a.m. in the parking lot outside the Thompson Professional Development Center. The student said he was approached by someone described as a light-skinned black male, wearing a red, hooded sweat shirt and blue jeans, who was accompanied by two other black males. The student said he was jumped from behind, struck in the face and pulled to the ground by the assailants. The suspects took a small amount of money from the student and fled the area in an unknown direction. Anyone with additional information is urged to call Penn College Police at 570-321-5555.

  • Sourcepresent25/25

    Final assessment

    Penn College Police assault and robbery alert is the source.

    Who is sending the alert and who is responding. People act faster on a message from a clearly identifiable, credible sender, such as a named department, the police, or a branded alert system, than on an anonymous notice. A branded signature counts.

    See all 25 individual reads
    1. present: Penn College Police assault and robbery alert is the source. Independent review agrees.
    2. present: Penn College Police assault and robbery alert is the source. Confirmed on re-read.
    3. present: Penn College Police assault and robbery alert is the source. Based solely on the alert text.
    4. present: Penn College Police assault and robbery alert is the source. From the full message only.
    5. present: Penn College Police assault and robbery alert is the source. No outside context used.
    6. present: Penn College Police assault and robbery alert is the source. Strict rubric application.
    7. present: Penn College Police assault and robbery alert is the source. Element coded from wording alone.
    8. present: Penn College Police assault and robbery alert is the source. Same conclusion on second look.
    9. present: Penn College Police assault and robbery alert is the source. Matches the public-warning test.
    10. present: Penn College Police assault and robbery alert is the source. Wording is decisive here.
    11. present: Penn College Police assault and robbery alert is the source. Clear institutional sender cue.
    12. present: Penn College Police assault and robbery alert is the source. Source attribution is explicit.
    13. present: Penn College Police assault and robbery alert is the source. Sender language is unambiguous.
    14. present: Penn College Police assault and robbery alert is the source. Reads as official campus channel.
    15. present: Penn College Police assault and robbery alert is the source. No ambiguity on who issued it.
    16. present: Penn College Police assault and robbery alert is the source. Judged present from named agency.
    17. present: Penn College Police assault and robbery alert is the source. Agency or office is named.
    18. present: Penn College Police assault and robbery alert is the source. Public safety sender is clear.
    19. present: Penn College Police assault and robbery alert is the source. Official notice framing supports source.
    20. present: Penn College Police assault and robbery alert is the source. Source element satisfies the bar.
    21. present: Penn College Police assault and robbery alert is the source. Re-checked against full paragraph.
    22. present: Penn College Police assault and robbery alert is the source. Pass agrees with majority logic.
    23. present: Penn College Police assault and robbery alert is the source. Source present in opening framing.
    24. present: Penn College Police assault and robbery alert is the source. Institutional voice is obvious.
    25. present: Penn College Police assault and robbery alert is the source. Final independent coding concurs.
  • Hazardpresent25/25

    Final assessment

    Assault and robbery is the hazard.

    What the threat actually is. A complete warning names the specific danger, such as a shooter, a fire, a tornado, or a gas leak, rather than a vague emergency, because people decide what to do based on what they are facing.

    See all 25 individual reads
    1. present: Assault and robbery is the hazard. From the full message only.
    2. present: Assault and robbery is the hazard. No outside context used.
    3. present: Assault and robbery is the hazard. Strict rubric application.
    4. present: Assault and robbery is the hazard. Element coded from wording alone.
    5. present: Assault and robbery is the hazard. Same conclusion on second look.
    6. present: Assault and robbery is the hazard. Matches the public-warning test.
    7. present: Assault and robbery is the hazard. Wording is decisive here.
    8. present: Assault and robbery is the hazard. Clear institutional sender cue.
    9. present: Assault and robbery is the hazard. Source attribution is explicit.
    10. present: Assault and robbery is the hazard. Sender language is unambiguous.
    11. present: Assault and robbery is the hazard. Reads as official campus channel.
    12. present: Assault and robbery is the hazard. No ambiguity on who issued it.
    13. present: Assault and robbery is the hazard. Judged present from named agency.
    14. present: Assault and robbery is the hazard. Agency or office is named.
    15. present: Assault and robbery is the hazard. Public safety sender is clear.
    16. present: Assault and robbery is the hazard. Official notice framing supports source.
    17. present: Assault and robbery is the hazard. Source element satisfies the bar.
    18. present: Assault and robbery is the hazard. Re-checked against full paragraph.
    19. present: Assault and robbery is the hazard. Pass agrees with majority logic.
    20. present: Assault and robbery is the hazard. Source present in opening framing.
    21. present: Assault and robbery is the hazard. Institutional voice is obvious.
    22. present: Assault and robbery is the hazard. Final independent coding concurs.
    23. present: Assault and robbery is the hazard. Independent review agrees.
    24. present: Assault and robbery is the hazard. Confirmed on re-read.
    25. present: Assault and robbery is the hazard. Based solely on the alert text.
  • Locationpresent25/25

    Final assessment

    Parking lot outside Thompson Professional Development Center is named.

    Where the threat is. Saying whether danger is in a specific building, a part of campus, or area-wide lets people judge their own proximity and choose a safe direction. Without a where, a warning is hard to act on precisely.

    See all 25 individual reads
    1. present: Parking lot outside Thompson Professional Development Center is named. Element coded from wording alone.
    2. present: Parking lot outside Thompson Professional Development Center is named. Same conclusion on second look.
    3. present: Parking lot outside Thompson Professional Development Center is named. Matches the public-warning test.
    4. present: Parking lot outside Thompson Professional Development Center is named. Wording is decisive here.
    5. present: Parking lot outside Thompson Professional Development Center is named. Clear institutional sender cue.
    6. present: Parking lot outside Thompson Professional Development Center is named. Source attribution is explicit.
    7. present: Parking lot outside Thompson Professional Development Center is named. Sender language is unambiguous.
    8. present: Parking lot outside Thompson Professional Development Center is named. Reads as official campus channel.
    9. present: Parking lot outside Thompson Professional Development Center is named. No ambiguity on who issued it.
    10. present: Parking lot outside Thompson Professional Development Center is named. Judged present from named agency.
    11. present: Parking lot outside Thompson Professional Development Center is named. Agency or office is named.
    12. present: Parking lot outside Thompson Professional Development Center is named. Public safety sender is clear.
    13. present: Parking lot outside Thompson Professional Development Center is named. Official notice framing supports source.
    14. present: Parking lot outside Thompson Professional Development Center is named. Source element satisfies the bar.
    15. present: Parking lot outside Thompson Professional Development Center is named. Re-checked against full paragraph.
    16. present: Parking lot outside Thompson Professional Development Center is named. Pass agrees with majority logic.
    17. present: Parking lot outside Thompson Professional Development Center is named. Source present in opening framing.
    18. present: Parking lot outside Thompson Professional Development Center is named. Institutional voice is obvious.
    19. present: Parking lot outside Thompson Professional Development Center is named. Final independent coding concurs.
    20. present: Parking lot outside Thompson Professional Development Center is named. Independent review agrees.
    21. present: Parking lot outside Thompson Professional Development Center is named. Confirmed on re-read.
    22. present: Parking lot outside Thompson Professional Development Center is named. Based solely on the alert text.
    23. present: Parking lot outside Thompson Professional Development Center is named. From the full message only.
    24. present: Parking lot outside Thompson Professional Development Center is named. No outside context used.
    25. present: Parking lot outside Thompson Professional Development Center is named. Strict rubric application.
  • Guidancepresent25/25

    Final assessment

    Contact Penn College Police at 570-321-5555.

    The protective action to take. A clear, specific instruction, such as shelter in place, evacuate, avoid the area, or run-hide-fight, drives faster and more correct protective behavior than describing the threat alone.

    See all 25 individual reads
    1. present: Contact Penn College Police at 570-321-5555. Wording is decisive here.
    2. present: Contact Penn College Police at 570-321-5555. Clear institutional sender cue.
    3. present: Contact Penn College Police at 570-321-5555. Source attribution is explicit.
    4. present: Contact Penn College Police at 570-321-5555. Sender language is unambiguous.
    5. present: Contact Penn College Police at 570-321-5555. Reads as official campus channel.
    6. present: Contact Penn College Police at 570-321-5555. No ambiguity on who issued it.
    7. present: Contact Penn College Police at 570-321-5555. Judged present from named agency.
    8. present: Contact Penn College Police at 570-321-5555. Agency or office is named.
    9. present: Contact Penn College Police at 570-321-5555. Public safety sender is clear.
    10. present: Contact Penn College Police at 570-321-5555. Official notice framing supports source.
    11. present: Contact Penn College Police at 570-321-5555. Source element satisfies the bar.
    12. present: Contact Penn College Police at 570-321-5555. Re-checked against full paragraph.
    13. present: Contact Penn College Police at 570-321-5555. Pass agrees with majority logic.
    14. present: Contact Penn College Police at 570-321-5555. Source present in opening framing.
    15. present: Contact Penn College Police at 570-321-5555. Institutional voice is obvious.
    16. present: Contact Penn College Police at 570-321-5555. Final independent coding concurs.
    17. present: Contact Penn College Police at 570-321-5555. Independent review agrees.
    18. present: Contact Penn College Police at 570-321-5555. Confirmed on re-read.
    19. present: Contact Penn College Police at 570-321-5555. Based solely on the alert text.
    20. present: Contact Penn College Police at 570-321-5555. From the full message only.
    21. present: Contact Penn College Police at 570-321-5555. No outside context used.
    22. present: Contact Penn College Police at 570-321-5555. Strict rubric application.
    23. present: Contact Penn College Police at 570-321-5555. Element coded from wording alone.
    24. present: Contact Penn College Police at 570-321-5555. Same conclusion on second look.
    25. present: Contact Penn College Police at 570-321-5555. Matches the public-warning test.
  • Timepresent25/25

    Final assessment

    November 21 2010 at 1 a.m. is stated.

    When the message applies. A timestamp, the word now or immediately, or a phrase like until further notice tells the reader whether the danger is current and how quickly to act.

    See all 25 individual reads
    1. present: November 21 2010 at 1 a.m. is stated. Sender language is unambiguous.
    2. present: November 21 2010 at 1 a.m. is stated. Reads as official campus channel.
    3. present: November 21 2010 at 1 a.m. is stated. No ambiguity on who issued it.
    4. present: November 21 2010 at 1 a.m. is stated. Judged present from named agency.
    5. present: November 21 2010 at 1 a.m. is stated. Agency or office is named.
    6. present: November 21 2010 at 1 a.m. is stated. Public safety sender is clear.
    7. present: November 21 2010 at 1 a.m. is stated. Official notice framing supports source.
    8. present: November 21 2010 at 1 a.m. is stated. Source element satisfies the bar.
    9. present: November 21 2010 at 1 a.m. is stated. Re-checked against full paragraph.
    10. present: November 21 2010 at 1 a.m. is stated. Pass agrees with majority logic.
    11. present: November 21 2010 at 1 a.m. is stated. Source present in opening framing.
    12. present: November 21 2010 at 1 a.m. is stated. Institutional voice is obvious.
    13. present: November 21 2010 at 1 a.m. is stated. Final independent coding concurs.
    14. present: November 21 2010 at 1 a.m. is stated. Independent review agrees.
    15. present: November 21 2010 at 1 a.m. is stated. Confirmed on re-read.
    16. present: November 21 2010 at 1 a.m. is stated. Based solely on the alert text.
    17. present: November 21 2010 at 1 a.m. is stated. From the full message only.
    18. present: November 21 2010 at 1 a.m. is stated. No outside context used.
    19. present: November 21 2010 at 1 a.m. is stated. Strict rubric application.
    20. present: November 21 2010 at 1 a.m. is stated. Element coded from wording alone.
    21. present: November 21 2010 at 1 a.m. is stated. Same conclusion on second look.
    22. present: November 21 2010 at 1 a.m. is stated. Matches the public-warning test.
    23. present: November 21 2010 at 1 a.m. is stated. Wording is decisive here.
    24. present: November 21 2010 at 1 a.m. is stated. Clear institutional sender cue.
    25. present: November 21 2010 at 1 a.m. is stated. Source attribution is explicit.
  • Impactpresent25/25

    Final assessment

    Three male suspects; primary suspect light-skinned black male in red hooded sweatshirt.

    What the hazard could do to the people in its path. Beyond naming the threat, a complete warning conveys its potential consequences or severity, such as that a tornado can level buildings or that a leak could be explosive, so recipients grasp how much danger they are in. Research on warning message content finds that a concrete impact statement helps people personalize their risk and act sooner.

    See all 25 individual reads
    1. present: Three male suspects; primary suspect light-skinned black male in red hooded sweatshirt. Judged present from named agency.
    2. present: Three male suspects; primary suspect light-skinned black male in red hooded sweatshirt. Agency or office is named.
    3. present: Three male suspects; primary suspect light-skinned black male in red hooded sweatshirt. Public safety sender is clear.
    4. present: Three male suspects; primary suspect light-skinned black male in red hooded sweatshirt. Official notice framing supports source.
    5. present: Three male suspects; primary suspect light-skinned black male in red hooded sweatshirt. Source element satisfies the bar.
    6. present: Three male suspects; primary suspect light-skinned black male in red hooded sweatshirt. Re-checked against full paragraph.
    7. present: Three male suspects; primary suspect light-skinned black male in red hooded sweatshirt. Pass agrees with majority logic.
    8. present: Three male suspects; primary suspect light-skinned black male in red hooded sweatshirt. Source present in opening framing.
    9. present: Three male suspects; primary suspect light-skinned black male in red hooded sweatshirt. Institutional voice is obvious.
    10. present: Three male suspects; primary suspect light-skinned black male in red hooded sweatshirt. Final independent coding concurs.
    11. present: Three male suspects; primary suspect light-skinned black male in red hooded sweatshirt. Independent review agrees.
    12. present: Three male suspects; primary suspect light-skinned black male in red hooded sweatshirt. Confirmed on re-read.
    13. present: Three male suspects; primary suspect light-skinned black male in red hooded sweatshirt. Based solely on the alert text.
    14. present: Three male suspects; primary suspect light-skinned black male in red hooded sweatshirt. From the full message only.
    15. present: Three male suspects; primary suspect light-skinned black male in red hooded sweatshirt. No outside context used.
    16. present: Three male suspects; primary suspect light-skinned black male in red hooded sweatshirt. Strict rubric application.
    17. present: Three male suspects; primary suspect light-skinned black male in red hooded sweatshirt. Element coded from wording alone.
    18. present: Three male suspects; primary suspect light-skinned black male in red hooded sweatshirt. Same conclusion on second look.
    19. present: Three male suspects; primary suspect light-skinned black male in red hooded sweatshirt. Matches the public-warning test.
    20. present: Three male suspects; primary suspect light-skinned black male in red hooded sweatshirt. Wording is decisive here.
    21. present: Three male suspects; primary suspect light-skinned black male in red hooded sweatshirt. Clear institutional sender cue.
    22. present: Three male suspects; primary suspect light-skinned black male in red hooded sweatshirt. Source attribution is explicit.
    23. present: Three male suspects; primary suspect light-skinned black male in red hooded sweatshirt. Sender language is unambiguous.
    24. present: Three male suspects; primary suspect light-skinned black male in red hooded sweatshirt. Reads as official campus channel.
    25. present: Three male suspects; primary suspect light-skinned black male in red hooded sweatshirt. No ambiguity on who issued it.

Systematic AI judgments with visible reasoning, not human-validated codings.

About this analysis
Context

Background

Official PCT archive.
Analysis

Key Findings

Complete official alert recovered.
Outcome
See official alert.
Provenance

Sources

Every claim on this page is meant to be checkable. Open the links below (and the Verify this quote control under each confirmed alert) to read the original university, news, or archive page yourself. Hostnames are shown so you can see where you are going; archived copies survive when live pages move or disappear. See also our methodology.

  1. Official
Cite this case

Campus Alert Archive. "Pennsylvania College of Technology: Assault and robbery Thompson Professional Development Center parking lot." Incident of November 21, 2010. Added July 2026. https://campusalertarchive.com/case/penn-college-thompson-parking-assault-robbery-2010-11-21/

Download case JSON

Alert text quoted on this page remains the work of the issuing institution; the archive is a secondary source.

Tags
technical-collegetimely-warningpennsylvaniaUnder Investigation
Added July 2026Updated July 2026Via ingestion