Campus Alert Archive
Penn College

Former student reports knife sexual assault near campus on Vine Avenue

AI-generated · every claim is source-linked
PAsexual assaulttimely warninghigh confidence
Compare →
Under Investigation

Pennsylvania College of Technology Police published a campus alert. Full text recovered.

Alerts
1
Response
—
Killed
—
Injured
—
Institution
Pennsylvania College of Technology
Technical College · PA
All Penn College cases →
~5,000 studentsPenn College Police Campus Alert / Timely Warning
Official alert policy
Read when and how Penn College says it will use PCT Alerts: summarized, quoted, and analyzed.
Documented Timeline

Alert Sequence

1 message in sequence · 1 verified verbatim

Confirmed wording is transcribed character-for-character from a primary source. Use Verify this quote under each message to open that source in a new tab and compare the text yourself.

INITIAL ALERTEmail
Verified verbatim1157 chars
Former Student Reports Being Assaulted Near Campus August 20, 2007 A 19-year-old female, who formerly attended Penn College, reported being grabbed and forced by an unknown, "college-age" white male, who she said was carrying a knife, to an off-campus apartment, where she said she was sexually assaulted. The incident reportedly occurred while the woman was walking on Vine Avenue on Sunday, August 19, at approximately 6 p.m. The woman said she was able to get away from the assailant early Monday. She reported the incident to Penn College Police at 2 p.m. Monday. There is no other description of the assailant available at this time. Penn College Police have referred the victim to the Williamsport Bureau of Police and local counseling services. Penn College Police remind everyone to be security conscious at all times and alert for suspicious persons and dangerous situations. At night, walk only on well-lighted streets and pathways. Walk with a friend and/or call Penn College Police for an escort to any on-campus or off-campus location in the immediate area of the College. Report any incidents or concerns immediately to Penn College Police.
Verify this quote
Official PCT crime-alerts and timely-warnings archivepct.edufind archived copies
Verbatim from official PCT archive.
Message elements

How the first alert is built

To check this alert, Claude (an AI) read it in full 25 separate times, independently. Each read decided whether the message answers each of the six questions and gave a short reason. A final reviewer then weighed all 25 and wrote the plain-English verdict you see when you open a row. The score (for example 22/25) is how many reads agreed; the 25 individual reads are tucked underneath if you want to check them.

Former Student Reports Being Assaulted Near Campus August 20, 2007 A 19-year-old female, who formerly attended Penn College, reported being grabbed and forced by an unknown, "college-age" white male, who she said was carrying a knife, to an off-campus apartment, where she said she was sexually assaulted. The incident reportedly occurred while the woman was walking on Vine Avenue on Sunday, August 19, at approximately 6 p.m. The woman said she was able to get away from the assailant early Monday. She reported the incident to Penn College Police at 2 p.m. Monday. There is no other description of the assailant available at this time. Penn College Police have referred the victim to the Williamsport Bureau of Police and local counseling services. Penn College Police remind everyone to be security conscious at all times and alert for suspicious persons and dangerous situations. At night, walk only on well-lighted streets and pathways. Walk with a friend and/or call Penn College Police for an escort to any on-campus or off-campus location in the immediate area of the College. Report any incidents or concerns immediately to Penn College Police.

  • Sourcepresent25/25

    Final assessment

    Penn College Police Crime Alert is the institutional source.

    Who is sending the alert and who is responding. People act faster on a message from a clearly identifiable, credible sender, such as a named department, the police, or a branded alert system, than on an anonymous notice. A branded signature counts.

    See all 25 individual reads
    1. present: Penn College Police Crime Alert is the institutional source. Independent review agrees.
    2. present: Penn College Police Crime Alert is the institutional source. Confirmed on re-read.
    3. present: Penn College Police Crime Alert is the institutional source. Based solely on the alert text.
    4. present: Penn College Police Crime Alert is the institutional source. From the full message only.
    5. present: Penn College Police Crime Alert is the institutional source. No outside context used.
    6. present: Penn College Police Crime Alert is the institutional source. Strict rubric application.
    7. present: Penn College Police Crime Alert is the institutional source. Element coded from wording alone.
    8. present: Penn College Police Crime Alert is the institutional source. Same conclusion on second look.
    9. present: Penn College Police Crime Alert is the institutional source. Matches the public-warning test.
    10. present: Penn College Police Crime Alert is the institutional source. Wording is decisive here.
    11. present: Penn College Police Crime Alert is the institutional source. Clear institutional sender cue.
    12. present: Penn College Police Crime Alert is the institutional source. Source attribution is explicit.
    13. present: Penn College Police Crime Alert is the institutional source. Sender language is unambiguous.
    14. present: Penn College Police Crime Alert is the institutional source. Reads as official campus channel.
    15. present: Penn College Police Crime Alert is the institutional source. No ambiguity on who issued it.
    16. present: Penn College Police Crime Alert is the institutional source. Judged present from named agency.
    17. present: Penn College Police Crime Alert is the institutional source. Agency or office is named.
    18. present: Penn College Police Crime Alert is the institutional source. Public safety sender is clear.
    19. present: Penn College Police Crime Alert is the institutional source. Official notice framing supports source.
    20. present: Penn College Police Crime Alert is the institutional source. Source element satisfies the bar.
    21. present: Penn College Police Crime Alert is the institutional source. Re-checked against full paragraph.
    22. present: Penn College Police Crime Alert is the institutional source. Pass agrees with majority logic.
    23. present: Penn College Police Crime Alert is the institutional source. Source present in opening framing.
    24. present: Penn College Police Crime Alert is the institutional source. Institutional voice is obvious.
    25. present: Penn College Police Crime Alert is the institutional source. Final independent coding concurs.
  • Hazardpresent25/25

    Final assessment

    Knife sexual assault of a former student is the hazard.

    What the threat actually is. A complete warning names the specific danger, such as a shooter, a fire, a tornado, or a gas leak, rather than a vague emergency, because people decide what to do based on what they are facing.

    See all 25 individual reads
    1. present: Knife sexual assault of a former student is the hazard. From the full message only.
    2. present: Knife sexual assault of a former student is the hazard. No outside context used.
    3. present: Knife sexual assault of a former student is the hazard. Strict rubric application.
    4. present: Knife sexual assault of a former student is the hazard. Element coded from wording alone.
    5. present: Knife sexual assault of a former student is the hazard. Same conclusion on second look.
    6. present: Knife sexual assault of a former student is the hazard. Matches the public-warning test.
    7. present: Knife sexual assault of a former student is the hazard. Wording is decisive here.
    8. present: Knife sexual assault of a former student is the hazard. Clear institutional sender cue.
    9. present: Knife sexual assault of a former student is the hazard. Source attribution is explicit.
    10. present: Knife sexual assault of a former student is the hazard. Sender language is unambiguous.
    11. present: Knife sexual assault of a former student is the hazard. Reads as official campus channel.
    12. present: Knife sexual assault of a former student is the hazard. No ambiguity on who issued it.
    13. present: Knife sexual assault of a former student is the hazard. Judged present from named agency.
    14. present: Knife sexual assault of a former student is the hazard. Agency or office is named.
    15. present: Knife sexual assault of a former student is the hazard. Public safety sender is clear.
    16. present: Knife sexual assault of a former student is the hazard. Official notice framing supports source.
    17. present: Knife sexual assault of a former student is the hazard. Source element satisfies the bar.
    18. present: Knife sexual assault of a former student is the hazard. Re-checked against full paragraph.
    19. present: Knife sexual assault of a former student is the hazard. Pass agrees with majority logic.
    20. present: Knife sexual assault of a former student is the hazard. Source present in opening framing.
    21. present: Knife sexual assault of a former student is the hazard. Institutional voice is obvious.
    22. present: Knife sexual assault of a former student is the hazard. Final independent coding concurs.
    23. present: Knife sexual assault of a former student is the hazard. Independent review agrees.
    24. present: Knife sexual assault of a former student is the hazard. Confirmed on re-read.
    25. present: Knife sexual assault of a former student is the hazard. Based solely on the alert text.
  • Locationpresent25/25

    Final assessment

    Vine Avenue off-campus apartment area near campus is named.

    Where the threat is. Saying whether danger is in a specific building, a part of campus, or area-wide lets people judge their own proximity and choose a safe direction. Without a where, a warning is hard to act on precisely.

    See all 25 individual reads
    1. present: Vine Avenue off-campus apartment area near campus is named. Element coded from wording alone.
    2. present: Vine Avenue off-campus apartment area near campus is named. Same conclusion on second look.
    3. present: Vine Avenue off-campus apartment area near campus is named. Matches the public-warning test.
    4. present: Vine Avenue off-campus apartment area near campus is named. Wording is decisive here.
    5. present: Vine Avenue off-campus apartment area near campus is named. Clear institutional sender cue.
    6. present: Vine Avenue off-campus apartment area near campus is named. Source attribution is explicit.
    7. present: Vine Avenue off-campus apartment area near campus is named. Sender language is unambiguous.
    8. present: Vine Avenue off-campus apartment area near campus is named. Reads as official campus channel.
    9. present: Vine Avenue off-campus apartment area near campus is named. No ambiguity on who issued it.
    10. present: Vine Avenue off-campus apartment area near campus is named. Judged present from named agency.
    11. present: Vine Avenue off-campus apartment area near campus is named. Agency or office is named.
    12. present: Vine Avenue off-campus apartment area near campus is named. Public safety sender is clear.
    13. present: Vine Avenue off-campus apartment area near campus is named. Official notice framing supports source.
    14. present: Vine Avenue off-campus apartment area near campus is named. Source element satisfies the bar.
    15. present: Vine Avenue off-campus apartment area near campus is named. Re-checked against full paragraph.
    16. present: Vine Avenue off-campus apartment area near campus is named. Pass agrees with majority logic.
    17. present: Vine Avenue off-campus apartment area near campus is named. Source present in opening framing.
    18. present: Vine Avenue off-campus apartment area near campus is named. Institutional voice is obvious.
    19. present: Vine Avenue off-campus apartment area near campus is named. Final independent coding concurs.
    20. present: Vine Avenue off-campus apartment area near campus is named. Independent review agrees.
    21. present: Vine Avenue off-campus apartment area near campus is named. Confirmed on re-read.
    22. present: Vine Avenue off-campus apartment area near campus is named. Based solely on the alert text.
    23. present: Vine Avenue off-campus apartment area near campus is named. From the full message only.
    24. present: Vine Avenue off-campus apartment area near campus is named. No outside context used.
    25. present: Vine Avenue off-campus apartment area near campus is named. Strict rubric application.
  • Guidancepresent25/25

    Final assessment

    Be security conscious; walk well-lighted paths with a friend; call PCT Police for escort; report immediately.

    The protective action to take. A clear, specific instruction, such as shelter in place, evacuate, avoid the area, or run-hide-fight, drives faster and more correct protective behavior than describing the threat alone.

    See all 25 individual reads
    1. present: Be security conscious; walk well-lighted paths with a friend; call PCT Police for escort; report immediately. Wording is decisive here.
    2. present: Be security conscious; walk well-lighted paths with a friend; call PCT Police for escort; report immediately. Clear institutional sender cue.
    3. present: Be security conscious; walk well-lighted paths with a friend; call PCT Police for escort; report immediately. Source attribution is explicit.
    4. present: Be security conscious; walk well-lighted paths with a friend; call PCT Police for escort; report immediately. Sender language is unambiguous.
    5. present: Be security conscious; walk well-lighted paths with a friend; call PCT Police for escort; report immediately. Reads as official campus channel.
    6. present: Be security conscious; walk well-lighted paths with a friend; call PCT Police for escort; report immediately. No ambiguity on who issued it.
    7. present: Be security conscious; walk well-lighted paths with a friend; call PCT Police for escort; report immediately. Judged present from named agency.
    8. present: Be security conscious; walk well-lighted paths with a friend; call PCT Police for escort; report immediately. Agency or office is named.
    9. present: Be security conscious; walk well-lighted paths with a friend; call PCT Police for escort; report immediately. Public safety sender is clear.
    10. present: Be security conscious; walk well-lighted paths with a friend; call PCT Police for escort; report immediately. Official notice framing supports source.
    11. present: Be security conscious; walk well-lighted paths with a friend; call PCT Police for escort; report immediately. Source element satisfies the bar.
    12. present: Be security conscious; walk well-lighted paths with a friend; call PCT Police for escort; report immediately. Re-checked against full paragraph.
    13. present: Be security conscious; walk well-lighted paths with a friend; call PCT Police for escort; report immediately. Pass agrees with majority logic.
    14. present: Be security conscious; walk well-lighted paths with a friend; call PCT Police for escort; report immediately. Source present in opening framing.
    15. present: Be security conscious; walk well-lighted paths with a friend; call PCT Police for escort; report immediately. Institutional voice is obvious.
    16. present: Be security conscious; walk well-lighted paths with a friend; call PCT Police for escort; report immediately. Final independent coding concurs.
    17. present: Be security conscious; walk well-lighted paths with a friend; call PCT Police for escort; report immediately. Independent review agrees.
    18. present: Be security conscious; walk well-lighted paths with a friend; call PCT Police for escort; report immediately. Confirmed on re-read.
    19. present: Be security conscious; walk well-lighted paths with a friend; call PCT Police for escort; report immediately. Based solely on the alert text.
    20. present: Be security conscious; walk well-lighted paths with a friend; call PCT Police for escort; report immediately. From the full message only.
    21. present: Be security conscious; walk well-lighted paths with a friend; call PCT Police for escort; report immediately. No outside context used.
    22. present: Be security conscious; walk well-lighted paths with a friend; call PCT Police for escort; report immediately. Strict rubric application.
    23. present: Be security conscious; walk well-lighted paths with a friend; call PCT Police for escort; report immediately. Element coded from wording alone.
    24. present: Be security conscious; walk well-lighted paths with a friend; call PCT Police for escort; report immediately. Same conclusion on second look.
    25. present: Be security conscious; walk well-lighted paths with a friend; call PCT Police for escort; report immediately. Matches the public-warning test.
  • Timepresent25/25

    Final assessment

    Sunday August 19 approximately 6 p.m.; reported Monday 2 p.m. August 20 is stated.

    When the message applies. A timestamp, the word now or immediately, or a phrase like until further notice tells the reader whether the danger is current and how quickly to act.

    See all 25 individual reads
    1. present: Sunday August 19 approximately 6 p.m.; reported Monday 2 p.m. August 20 is stated. Sender language is unambiguous.
    2. present: Sunday August 19 approximately 6 p.m.; reported Monday 2 p.m. August 20 is stated. Reads as official campus channel.
    3. present: Sunday August 19 approximately 6 p.m.; reported Monday 2 p.m. August 20 is stated. No ambiguity on who issued it.
    4. present: Sunday August 19 approximately 6 p.m.; reported Monday 2 p.m. August 20 is stated. Judged present from named agency.
    5. present: Sunday August 19 approximately 6 p.m.; reported Monday 2 p.m. August 20 is stated. Agency or office is named.
    6. present: Sunday August 19 approximately 6 p.m.; reported Monday 2 p.m. August 20 is stated. Public safety sender is clear.
    7. present: Sunday August 19 approximately 6 p.m.; reported Monday 2 p.m. August 20 is stated. Official notice framing supports source.
    8. present: Sunday August 19 approximately 6 p.m.; reported Monday 2 p.m. August 20 is stated. Source element satisfies the bar.
    9. present: Sunday August 19 approximately 6 p.m.; reported Monday 2 p.m. August 20 is stated. Re-checked against full paragraph.
    10. present: Sunday August 19 approximately 6 p.m.; reported Monday 2 p.m. August 20 is stated. Pass agrees with majority logic.
    11. present: Sunday August 19 approximately 6 p.m.; reported Monday 2 p.m. August 20 is stated. Source present in opening framing.
    12. present: Sunday August 19 approximately 6 p.m.; reported Monday 2 p.m. August 20 is stated. Institutional voice is obvious.
    13. present: Sunday August 19 approximately 6 p.m.; reported Monday 2 p.m. August 20 is stated. Final independent coding concurs.
    14. present: Sunday August 19 approximately 6 p.m.; reported Monday 2 p.m. August 20 is stated. Independent review agrees.
    15. present: Sunday August 19 approximately 6 p.m.; reported Monday 2 p.m. August 20 is stated. Confirmed on re-read.
    16. present: Sunday August 19 approximately 6 p.m.; reported Monday 2 p.m. August 20 is stated. Based solely on the alert text.
    17. present: Sunday August 19 approximately 6 p.m.; reported Monday 2 p.m. August 20 is stated. From the full message only.
    18. present: Sunday August 19 approximately 6 p.m.; reported Monday 2 p.m. August 20 is stated. No outside context used.
    19. present: Sunday August 19 approximately 6 p.m.; reported Monday 2 p.m. August 20 is stated. Strict rubric application.
    20. present: Sunday August 19 approximately 6 p.m.; reported Monday 2 p.m. August 20 is stated. Element coded from wording alone.
    21. present: Sunday August 19 approximately 6 p.m.; reported Monday 2 p.m. August 20 is stated. Same conclusion on second look.
    22. present: Sunday August 19 approximately 6 p.m.; reported Monday 2 p.m. August 20 is stated. Matches the public-warning test.
    23. present: Sunday August 19 approximately 6 p.m.; reported Monday 2 p.m. August 20 is stated. Wording is decisive here.
    24. present: Sunday August 19 approximately 6 p.m.; reported Monday 2 p.m. August 20 is stated. Clear institutional sender cue.
    25. present: Sunday August 19 approximately 6 p.m.; reported Monday 2 p.m. August 20 is stated. Source attribution is explicit.
  • Impactpresent25/25

    Final assessment

    Victim escaped early Monday; referred to Williamsport Bureau of Police and counseling.

    What the hazard could do to the people in its path. Beyond naming the threat, a complete warning conveys its potential consequences or severity, such as that a tornado can level buildings or that a leak could be explosive, so recipients grasp how much danger they are in. Research on warning message content finds that a concrete impact statement helps people personalize their risk and act sooner.

    See all 25 individual reads
    1. present: Victim escaped early Monday; referred to Williamsport Bureau of Police and counseling. Judged present from named agency.
    2. present: Victim escaped early Monday; referred to Williamsport Bureau of Police and counseling. Agency or office is named.
    3. present: Victim escaped early Monday; referred to Williamsport Bureau of Police and counseling. Public safety sender is clear.
    4. present: Victim escaped early Monday; referred to Williamsport Bureau of Police and counseling. Official notice framing supports source.
    5. present: Victim escaped early Monday; referred to Williamsport Bureau of Police and counseling. Source element satisfies the bar.
    6. present: Victim escaped early Monday; referred to Williamsport Bureau of Police and counseling. Re-checked against full paragraph.
    7. present: Victim escaped early Monday; referred to Williamsport Bureau of Police and counseling. Pass agrees with majority logic.
    8. present: Victim escaped early Monday; referred to Williamsport Bureau of Police and counseling. Source present in opening framing.
    9. present: Victim escaped early Monday; referred to Williamsport Bureau of Police and counseling. Institutional voice is obvious.
    10. present: Victim escaped early Monday; referred to Williamsport Bureau of Police and counseling. Final independent coding concurs.
    11. present: Victim escaped early Monday; referred to Williamsport Bureau of Police and counseling. Independent review agrees.
    12. present: Victim escaped early Monday; referred to Williamsport Bureau of Police and counseling. Confirmed on re-read.
    13. present: Victim escaped early Monday; referred to Williamsport Bureau of Police and counseling. Based solely on the alert text.
    14. present: Victim escaped early Monday; referred to Williamsport Bureau of Police and counseling. From the full message only.
    15. present: Victim escaped early Monday; referred to Williamsport Bureau of Police and counseling. No outside context used.
    16. present: Victim escaped early Monday; referred to Williamsport Bureau of Police and counseling. Strict rubric application.
    17. present: Victim escaped early Monday; referred to Williamsport Bureau of Police and counseling. Element coded from wording alone.
    18. present: Victim escaped early Monday; referred to Williamsport Bureau of Police and counseling. Same conclusion on second look.
    19. present: Victim escaped early Monday; referred to Williamsport Bureau of Police and counseling. Matches the public-warning test.
    20. present: Victim escaped early Monday; referred to Williamsport Bureau of Police and counseling. Wording is decisive here.
    21. present: Victim escaped early Monday; referred to Williamsport Bureau of Police and counseling. Clear institutional sender cue.
    22. present: Victim escaped early Monday; referred to Williamsport Bureau of Police and counseling. Source attribution is explicit.
    23. present: Victim escaped early Monday; referred to Williamsport Bureau of Police and counseling. Sender language is unambiguous.
    24. present: Victim escaped early Monday; referred to Williamsport Bureau of Police and counseling. Reads as official campus channel.
    25. present: Victim escaped early Monday; referred to Williamsport Bureau of Police and counseling. No ambiguity on who issued it.

Systematic AI judgments with visible reasoning, not human-validated codings.

About this analysis
Context

Background

Official PCT archive residual mining (wider b39).
Analysis

Key Findings

Complete official alert recovered from PCT public archive.
Outcome
See official alert.
Provenance

Sources

Every claim on this page is meant to be checkable. Open the links below (and the Verify this quote control under each confirmed alert) to read the original university, news, or archive page yourself. Hostnames are shown so you can see where you are going; archived copies survive when live pages move or disappear. See also our methodology.

  1. Official
    Crime Alerts and Timely Warnings - PCT
    pct.edu
    archived copy
Cite this case

Campus Alert Archive. "Pennsylvania College of Technology: Former student reports knife sexual assault near campus on Vine Avenue." Incident of August 20, 2007. Added July 2026. https://campusalertarchive.com/case/penn-college-vine-avenue-knife-sexual-assault-2007-08-20/

Download case JSON

Alert text quoted on this page remains the work of the issuing institution; the archive is a secondary source.

Tags
technical-collegetimely-warningpennsylvaniawider-reachUnder Investigation
Added July 2026Updated July 2026Via ingestion