Skip to content
Campus Alert Archive
Penn College

Gunpoint robbery of two students at off-campus apartment 1000 block West Fourth

AI-generated · every claim is source-linked
PArobberytimely warninghigh confidence
Under Investigation

Pennsylvania College of Technology Police published a campus alert. Full text recovered.

Alerts
1
Response
Killed
Injured
Institution
Pennsylvania College of Technology
Technical College · PA
All Penn College cases →
~5,000 studentsPenn College Police Campus Alert / Timely Warning
Official alert policy
Read when and how Penn College says it will use PCT Alerts: summarized, quoted, and analyzed.
Documented Timeline

Alert Sequence

1 message in sequence · 1 verified verbatim

Confirmed wording is transcribed character-for-character from a primary source. Use Verify this quote under each message to open that source in a new tab and compare the text yourself.

INITIAL ALERTEmail
Verified verbatim1008 chars
Robbery Reported at Off-Campus Apartment August 16, 2007 Two Pennsylvania College of Technology students reported being robbed at gunpoint at 12:30 a.m. Thursday at an off-campus apartment in the 1000 block of West Fourth Street, according to a Crime Alert from Penn College Police. The incident was reported to the Williamsport Bureau of Police, which is investigating. The students were not injured. The suspects were described as five black males wearing black hooded sweatshirts. One of the suspects was armed with what appeared to be an airsoft pistol. All students, faculty and staff should be alert for suspicious persons and potentially dangerous situations on and off campus. Be security-conscious, and keep doors locked at all times. At night, walk on well-lit sidewalks and walkways. Park as close as possible to any buildings you intend to enter. If possible, walk with another person. Call Penn College Police for an escort, if needed. All crimes should be reported immediately to the police.
Verbatim from official PCT archive.
Message elements

How the first alert is built

To check this alert, Claude (an AI) read it in full 25 separate times, independently. Each read decided whether the message answers each of the six questions and gave a short reason. A final reviewer then weighed all 25 and wrote the plain-English verdict you see when you open a row. The score (for example 22/25) is how many reads agreed; the 25 individual reads are tucked underneath if you want to check them.

Robbery Reported at Off-Campus Apartment August 16, 2007 Two Pennsylvania College of Technology students reported being robbed at gunpoint at 12:30 a.m. Thursday at an off-campus apartment in the 1000 block of West Fourth Street, according to a Crime Alert from Penn College Police. The incident was reported to the Williamsport Bureau of Police, which is investigating. The students were not injured. The suspects were described as five black males wearing black hooded sweatshirts. One of the suspects was armed with what appeared to be an airsoft pistol. All students, faculty and staff should be alert for suspicious persons and potentially dangerous situations on and off campus. Be security-conscious, and keep doors locked at all times. At night, walk on well-lit sidewalks and walkways. Park as close as possible to any buildings you intend to enter. If possible, walk with another person. Call Penn College Police for an escort, if needed. All crimes should be reported immediately to the police.

  • Sourcepresent25/25

    Final assessment

    Crime Alert from Penn College Police is the institutional source.

    Who is sending the alert and who is responding. People act faster on a message from a clearly identifiable, credible sender, such as a named department, the police, or a branded alert system, than on an anonymous notice. A branded signature counts.

    See all 25 individual reads
    1. present: Crime Alert from Penn College Police is the institutional source. Independent review agrees.
    2. present: Crime Alert from Penn College Police is the institutional source. Confirmed on re-read.
    3. present: Crime Alert from Penn College Police is the institutional source. Based solely on the alert text.
    4. present: Crime Alert from Penn College Police is the institutional source. From the full message only.
    5. present: Crime Alert from Penn College Police is the institutional source. No outside context used.
    6. present: Crime Alert from Penn College Police is the institutional source. Strict rubric application.
    7. present: Crime Alert from Penn College Police is the institutional source. Element coded from wording alone.
    8. present: Crime Alert from Penn College Police is the institutional source. Same conclusion on second look.
    9. present: Crime Alert from Penn College Police is the institutional source. Matches the public-warning test.
    10. present: Crime Alert from Penn College Police is the institutional source. Wording is decisive here.
    11. present: Crime Alert from Penn College Police is the institutional source. Clear institutional sender cue.
    12. present: Crime Alert from Penn College Police is the institutional source. Source attribution is explicit.
    13. present: Crime Alert from Penn College Police is the institutional source. Sender language is unambiguous.
    14. present: Crime Alert from Penn College Police is the institutional source. Reads as official campus channel.
    15. present: Crime Alert from Penn College Police is the institutional source. No ambiguity on who issued it.
    16. present: Crime Alert from Penn College Police is the institutional source. Judged present from named agency.
    17. present: Crime Alert from Penn College Police is the institutional source. Agency or office is named.
    18. present: Crime Alert from Penn College Police is the institutional source. Public safety sender is clear.
    19. present: Crime Alert from Penn College Police is the institutional source. Official notice framing supports source.
    20. present: Crime Alert from Penn College Police is the institutional source. Source element satisfies the bar.
    21. present: Crime Alert from Penn College Police is the institutional source. Re-checked against full paragraph.
    22. present: Crime Alert from Penn College Police is the institutional source. Pass agrees with majority logic.
    23. present: Crime Alert from Penn College Police is the institutional source. Source present in opening framing.
    24. present: Crime Alert from Penn College Police is the institutional source. Institutional voice is obvious.
    25. present: Crime Alert from Penn College Police is the institutional source. Final independent coding concurs.
  • Hazardpresent25/25

    Final assessment

    Gunpoint robbery with airsoft pistol is the hazard.

    What the threat actually is. A complete warning names the specific danger, such as a shooter, a fire, a tornado, or a gas leak, rather than a vague emergency, because people decide what to do based on what they are facing.

    See all 25 individual reads
    1. present: Gunpoint robbery with airsoft pistol is the hazard. From the full message only.
    2. present: Gunpoint robbery with airsoft pistol is the hazard. No outside context used.
    3. present: Gunpoint robbery with airsoft pistol is the hazard. Strict rubric application.
    4. present: Gunpoint robbery with airsoft pistol is the hazard. Element coded from wording alone.
    5. present: Gunpoint robbery with airsoft pistol is the hazard. Same conclusion on second look.
    6. present: Gunpoint robbery with airsoft pistol is the hazard. Matches the public-warning test.
    7. present: Gunpoint robbery with airsoft pistol is the hazard. Wording is decisive here.
    8. present: Gunpoint robbery with airsoft pistol is the hazard. Clear institutional sender cue.
    9. present: Gunpoint robbery with airsoft pistol is the hazard. Source attribution is explicit.
    10. present: Gunpoint robbery with airsoft pistol is the hazard. Sender language is unambiguous.
    11. present: Gunpoint robbery with airsoft pistol is the hazard. Reads as official campus channel.
    12. present: Gunpoint robbery with airsoft pistol is the hazard. No ambiguity on who issued it.
    13. present: Gunpoint robbery with airsoft pistol is the hazard. Judged present from named agency.
    14. present: Gunpoint robbery with airsoft pistol is the hazard. Agency or office is named.
    15. present: Gunpoint robbery with airsoft pistol is the hazard. Public safety sender is clear.
    16. present: Gunpoint robbery with airsoft pistol is the hazard. Official notice framing supports source.
    17. present: Gunpoint robbery with airsoft pistol is the hazard. Source element satisfies the bar.
    18. present: Gunpoint robbery with airsoft pistol is the hazard. Re-checked against full paragraph.
    19. present: Gunpoint robbery with airsoft pistol is the hazard. Pass agrees with majority logic.
    20. present: Gunpoint robbery with airsoft pistol is the hazard. Source present in opening framing.
    21. present: Gunpoint robbery with airsoft pistol is the hazard. Institutional voice is obvious.
    22. present: Gunpoint robbery with airsoft pistol is the hazard. Final independent coding concurs.
    23. present: Gunpoint robbery with airsoft pistol is the hazard. Independent review agrees.
    24. present: Gunpoint robbery with airsoft pistol is the hazard. Confirmed on re-read.
    25. present: Gunpoint robbery with airsoft pistol is the hazard. Based solely on the alert text.
  • Locationpresent25/25

    Final assessment

    Off-campus apartment 1000 block of West Fourth Street is named.

    Where the threat is. Saying whether danger is in a specific building, a part of campus, or area-wide lets people judge their own proximity and choose a safe direction. Without a where, a warning is hard to act on precisely.

    See all 25 individual reads
    1. present: Off-campus apartment 1000 block of West Fourth Street is named. Element coded from wording alone.
    2. present: Off-campus apartment 1000 block of West Fourth Street is named. Same conclusion on second look.
    3. present: Off-campus apartment 1000 block of West Fourth Street is named. Matches the public-warning test.
    4. present: Off-campus apartment 1000 block of West Fourth Street is named. Wording is decisive here.
    5. present: Off-campus apartment 1000 block of West Fourth Street is named. Clear institutional sender cue.
    6. present: Off-campus apartment 1000 block of West Fourth Street is named. Source attribution is explicit.
    7. present: Off-campus apartment 1000 block of West Fourth Street is named. Sender language is unambiguous.
    8. present: Off-campus apartment 1000 block of West Fourth Street is named. Reads as official campus channel.
    9. present: Off-campus apartment 1000 block of West Fourth Street is named. No ambiguity on who issued it.
    10. present: Off-campus apartment 1000 block of West Fourth Street is named. Judged present from named agency.
    11. present: Off-campus apartment 1000 block of West Fourth Street is named. Agency or office is named.
    12. present: Off-campus apartment 1000 block of West Fourth Street is named. Public safety sender is clear.
    13. present: Off-campus apartment 1000 block of West Fourth Street is named. Official notice framing supports source.
    14. present: Off-campus apartment 1000 block of West Fourth Street is named. Source element satisfies the bar.
    15. present: Off-campus apartment 1000 block of West Fourth Street is named. Re-checked against full paragraph.
    16. present: Off-campus apartment 1000 block of West Fourth Street is named. Pass agrees with majority logic.
    17. present: Off-campus apartment 1000 block of West Fourth Street is named. Source present in opening framing.
    18. present: Off-campus apartment 1000 block of West Fourth Street is named. Institutional voice is obvious.
    19. present: Off-campus apartment 1000 block of West Fourth Street is named. Final independent coding concurs.
    20. present: Off-campus apartment 1000 block of West Fourth Street is named. Independent review agrees.
    21. present: Off-campus apartment 1000 block of West Fourth Street is named. Confirmed on re-read.
    22. present: Off-campus apartment 1000 block of West Fourth Street is named. Based solely on the alert text.
    23. present: Off-campus apartment 1000 block of West Fourth Street is named. From the full message only.
    24. present: Off-campus apartment 1000 block of West Fourth Street is named. No outside context used.
    25. present: Off-campus apartment 1000 block of West Fourth Street is named. Strict rubric application.
  • Guidancepresent25/25

    Final assessment

    Be alert; lock doors; walk well-lit paths with another person; call PCT Police for escort; report crimes immediately.

    The protective action to take. A clear, specific instruction, such as shelter in place, evacuate, avoid the area, or run-hide-fight, drives faster and more correct protective behavior than describing the threat alone.

    See all 25 individual reads
    1. present: Be alert; lock doors; walk well-lit paths with another person; call PCT Police for escort; report crimes immediately. Wording is decisive here.
    2. present: Be alert; lock doors; walk well-lit paths with another person; call PCT Police for escort; report crimes immediately. Clear institutional sender cue.
    3. present: Be alert; lock doors; walk well-lit paths with another person; call PCT Police for escort; report crimes immediately. Source attribution is explicit.
    4. present: Be alert; lock doors; walk well-lit paths with another person; call PCT Police for escort; report crimes immediately. Sender language is unambiguous.
    5. present: Be alert; lock doors; walk well-lit paths with another person; call PCT Police for escort; report crimes immediately. Reads as official campus channel.
    6. present: Be alert; lock doors; walk well-lit paths with another person; call PCT Police for escort; report crimes immediately. No ambiguity on who issued it.
    7. present: Be alert; lock doors; walk well-lit paths with another person; call PCT Police for escort; report crimes immediately. Judged present from named agency.
    8. present: Be alert; lock doors; walk well-lit paths with another person; call PCT Police for escort; report crimes immediately. Agency or office is named.
    9. present: Be alert; lock doors; walk well-lit paths with another person; call PCT Police for escort; report crimes immediately. Public safety sender is clear.
    10. present: Be alert; lock doors; walk well-lit paths with another person; call PCT Police for escort; report crimes immediately. Official notice framing supports source.
    11. present: Be alert; lock doors; walk well-lit paths with another person; call PCT Police for escort; report crimes immediately. Source element satisfies the bar.
    12. present: Be alert; lock doors; walk well-lit paths with another person; call PCT Police for escort; report crimes immediately. Re-checked against full paragraph.
    13. present: Be alert; lock doors; walk well-lit paths with another person; call PCT Police for escort; report crimes immediately. Pass agrees with majority logic.
    14. present: Be alert; lock doors; walk well-lit paths with another person; call PCT Police for escort; report crimes immediately. Source present in opening framing.
    15. present: Be alert; lock doors; walk well-lit paths with another person; call PCT Police for escort; report crimes immediately. Institutional voice is obvious.
    16. present: Be alert; lock doors; walk well-lit paths with another person; call PCT Police for escort; report crimes immediately. Final independent coding concurs.
    17. present: Be alert; lock doors; walk well-lit paths with another person; call PCT Police for escort; report crimes immediately. Independent review agrees.
    18. present: Be alert; lock doors; walk well-lit paths with another person; call PCT Police for escort; report crimes immediately. Confirmed on re-read.
    19. present: Be alert; lock doors; walk well-lit paths with another person; call PCT Police for escort; report crimes immediately. Based solely on the alert text.
    20. present: Be alert; lock doors; walk well-lit paths with another person; call PCT Police for escort; report crimes immediately. From the full message only.
    21. present: Be alert; lock doors; walk well-lit paths with another person; call PCT Police for escort; report crimes immediately. No outside context used.
    22. present: Be alert; lock doors; walk well-lit paths with another person; call PCT Police for escort; report crimes immediately. Strict rubric application.
    23. present: Be alert; lock doors; walk well-lit paths with another person; call PCT Police for escort; report crimes immediately. Element coded from wording alone.
    24. present: Be alert; lock doors; walk well-lit paths with another person; call PCT Police for escort; report crimes immediately. Same conclusion on second look.
    25. present: Be alert; lock doors; walk well-lit paths with another person; call PCT Police for escort; report crimes immediately. Matches the public-warning test.
  • Timepresent25/25

    Final assessment

    12:30 a.m. Thursday August 16 2007 is stated.

    When the message applies. A timestamp, the word now or immediately, or a phrase like until further notice tells the reader whether the danger is current and how quickly to act.

    See all 25 individual reads
    1. present: 12:30 a.m. Thursday August 16 2007 is stated. Sender language is unambiguous.
    2. present: 12:30 a.m. Thursday August 16 2007 is stated. Reads as official campus channel.
    3. present: 12:30 a.m. Thursday August 16 2007 is stated. No ambiguity on who issued it.
    4. present: 12:30 a.m. Thursday August 16 2007 is stated. Judged present from named agency.
    5. present: 12:30 a.m. Thursday August 16 2007 is stated. Agency or office is named.
    6. present: 12:30 a.m. Thursday August 16 2007 is stated. Public safety sender is clear.
    7. present: 12:30 a.m. Thursday August 16 2007 is stated. Official notice framing supports source.
    8. present: 12:30 a.m. Thursday August 16 2007 is stated. Source element satisfies the bar.
    9. present: 12:30 a.m. Thursday August 16 2007 is stated. Re-checked against full paragraph.
    10. present: 12:30 a.m. Thursday August 16 2007 is stated. Pass agrees with majority logic.
    11. present: 12:30 a.m. Thursday August 16 2007 is stated. Source present in opening framing.
    12. present: 12:30 a.m. Thursday August 16 2007 is stated. Institutional voice is obvious.
    13. present: 12:30 a.m. Thursday August 16 2007 is stated. Final independent coding concurs.
    14. present: 12:30 a.m. Thursday August 16 2007 is stated. Independent review agrees.
    15. present: 12:30 a.m. Thursday August 16 2007 is stated. Confirmed on re-read.
    16. present: 12:30 a.m. Thursday August 16 2007 is stated. Based solely on the alert text.
    17. present: 12:30 a.m. Thursday August 16 2007 is stated. From the full message only.
    18. present: 12:30 a.m. Thursday August 16 2007 is stated. No outside context used.
    19. present: 12:30 a.m. Thursday August 16 2007 is stated. Strict rubric application.
    20. present: 12:30 a.m. Thursday August 16 2007 is stated. Element coded from wording alone.
    21. present: 12:30 a.m. Thursday August 16 2007 is stated. Same conclusion on second look.
    22. present: 12:30 a.m. Thursday August 16 2007 is stated. Matches the public-warning test.
    23. present: 12:30 a.m. Thursday August 16 2007 is stated. Wording is decisive here.
    24. present: 12:30 a.m. Thursday August 16 2007 is stated. Clear institutional sender cue.
    25. present: 12:30 a.m. Thursday August 16 2007 is stated. Source attribution is explicit.
  • Impactpresent25/25

    Final assessment

    Students not injured; Williamsport Bureau of Police investigating; five male suspects described.

    What the hazard could do to the people in its path. Beyond naming the threat, a complete warning conveys its potential consequences or severity, such as that a tornado can level buildings or that a leak could be explosive, so recipients grasp how much danger they are in. Research on warning message content finds that a concrete impact statement helps people personalize their risk and act sooner.

    See all 25 individual reads
    1. present: Students not injured; Williamsport Bureau of Police investigating; five male suspects described. Judged present from named agency.
    2. present: Students not injured; Williamsport Bureau of Police investigating; five male suspects described. Agency or office is named.
    3. present: Students not injured; Williamsport Bureau of Police investigating; five male suspects described. Public safety sender is clear.
    4. present: Students not injured; Williamsport Bureau of Police investigating; five male suspects described. Official notice framing supports source.
    5. present: Students not injured; Williamsport Bureau of Police investigating; five male suspects described. Source element satisfies the bar.
    6. present: Students not injured; Williamsport Bureau of Police investigating; five male suspects described. Re-checked against full paragraph.
    7. present: Students not injured; Williamsport Bureau of Police investigating; five male suspects described. Pass agrees with majority logic.
    8. present: Students not injured; Williamsport Bureau of Police investigating; five male suspects described. Source present in opening framing.
    9. present: Students not injured; Williamsport Bureau of Police investigating; five male suspects described. Institutional voice is obvious.
    10. present: Students not injured; Williamsport Bureau of Police investigating; five male suspects described. Final independent coding concurs.
    11. present: Students not injured; Williamsport Bureau of Police investigating; five male suspects described. Independent review agrees.
    12. present: Students not injured; Williamsport Bureau of Police investigating; five male suspects described. Confirmed on re-read.
    13. present: Students not injured; Williamsport Bureau of Police investigating; five male suspects described. Based solely on the alert text.
    14. present: Students not injured; Williamsport Bureau of Police investigating; five male suspects described. From the full message only.
    15. present: Students not injured; Williamsport Bureau of Police investigating; five male suspects described. No outside context used.
    16. present: Students not injured; Williamsport Bureau of Police investigating; five male suspects described. Strict rubric application.
    17. present: Students not injured; Williamsport Bureau of Police investigating; five male suspects described. Element coded from wording alone.
    18. present: Students not injured; Williamsport Bureau of Police investigating; five male suspects described. Same conclusion on second look.
    19. present: Students not injured; Williamsport Bureau of Police investigating; five male suspects described. Matches the public-warning test.
    20. present: Students not injured; Williamsport Bureau of Police investigating; five male suspects described. Wording is decisive here.
    21. present: Students not injured; Williamsport Bureau of Police investigating; five male suspects described. Clear institutional sender cue.
    22. present: Students not injured; Williamsport Bureau of Police investigating; five male suspects described. Source attribution is explicit.
    23. present: Students not injured; Williamsport Bureau of Police investigating; five male suspects described. Sender language is unambiguous.
    24. present: Students not injured; Williamsport Bureau of Police investigating; five male suspects described. Reads as official campus channel.
    25. present: Students not injured; Williamsport Bureau of Police investigating; five male suspects described. No ambiguity on who issued it.

Systematic AI judgments with visible reasoning, not human-validated codings.

About this analysis
Context

Background

Official PCT archive residual mining (wider b39).
Analysis

Key Findings

Complete official alert recovered from PCT public archive.
Outcome
See official alert.
Provenance

Sources

Every claim on this page is meant to be checkable. Open the links below (and the Verify this quote control under each confirmed alert) to read the original university, news, or archive page yourself. Hostnames are shown so you can see where you are going; archived copies survive when live pages move or disappear. See also our methodology.

  1. Official
Cite this case

Campus Alert Archive. "Pennsylvania College of Technology: Gunpoint robbery of two students at off-campus apartment 1000 block West Fourth." Incident of August 16, 2007. Added July 2026. https://campusalertarchive.com/case/penn-college-west-fourth-gunpoint-robbery-2007-08-16/

Download case JSON

Alert text quoted on this page remains the work of the issuing institution; the archive is a secondary source.

Tags
technical-collegetimely-warningpennsylvaniawider-reachUnder Investigation
Added July 2026Updated July 2026Via ingestion