Skip to content
Campus Alert Archive
Penn College

Two students assaulted and robbed 900 block West Fourth Street

AI-generated · every claim is source-linked
PArobberytimely warninghigh confidence
Under Investigation

Pennsylvania College of Technology Police published a campus alert. Full text recovered.

Alerts
1
Response
Killed
Injured
Institution
Pennsylvania College of Technology
Technical College · PA
All Penn College cases →
~5,000 studentsPenn College Police Campus Alert / Timely Warning
Official alert policy
Read when and how Penn College says it will use PCT Alerts: summarized, quoted, and analyzed.
Documented Timeline

Alert Sequence

1 message in sequence · 1 verified verbatim

Confirmed wording is transcribed character-for-character from a primary source. Use Verify this quote under each message to open that source in a new tab and compare the text yourself.

INITIAL ALERTEmail
Verified verbatim1184 chars
Robbery of Students Off Campus Two 24-year-old students reported being assaulted and robbed off campus in Williamsport on Saturday, November 23 at 2:10 a.m. The incident occurred in the 900 block of West Fourth Street while the students were walking back to their on-campus apartment. The students said they were jumped from behind by a group of five black males and assaulted. After they were assaulted the suspects took their cellular telephones and a wallet. The suspects then fled east on West Fourth Street. The only clothing description provided is the suspects were wearing hooded sweatshirts. The Williamsport Bureau Police are investigating. The Williamsport Bureau of Police are also investigating a similar assault downtown in the area of Perkins and Wegmans that occurred at 1:45 a.m. It was reported the two victims in that case, one male and one female, were not students. The Penn College Police have added additional off-campus patrols. Anyone with additional information about either of these incidents is urged to call Williamsport Bureau of Police at 570-327-7560 or Penn College Police at 570-321-5555. The Penn College Police offer escorts to and from campus.
Verbatim from official PCT archive.
Message elements

How the first alert is built

To check this alert, Claude (an AI) read it in full 25 separate times, independently. Each read decided whether the message answers each of the six questions and gave a short reason. A final reviewer then weighed all 25 and wrote the plain-English verdict you see when you open a row. The score (for example 22/25) is how many reads agreed; the 25 individual reads are tucked underneath if you want to check them.

Robbery of Students Off Campus Two 24-year-old students reported being assaulted and robbed off campus in Williamsport on Saturday, November 23 at 2:10 a.m. The incident occurred in the 900 block of West Fourth Street while the students were walking back to their on-campus apartment. The students said they were jumped from behind by a group of five black males and assaulted. After they were assaulted the suspects took their cellular telephones and a wallet. The suspects then fled east on West Fourth Street. The only clothing description provided is the suspects were wearing hooded sweatshirts. The Williamsport Bureau Police are investigating. The Williamsport Bureau of Police are also investigating a similar assault downtown in the area of Perkins and Wegmans that occurred at 1:45 a.m. It was reported the two victims in that case, one male and one female, were not students. The Penn College Police have added additional off-campus patrols. Anyone with additional information about either of these incidents is urged to call Williamsport Bureau of Police at 570-327-7560 or Penn College Police at 570-321-5555. The Penn College Police offer escorts to and from campus.

  • Sourcepresent25/25

    Final assessment

    Penn College Police Crime Alert is the institutional source.

    Who is sending the alert and who is responding. People act faster on a message from a clearly identifiable, credible sender, such as a named department, the police, or a branded alert system, than on an anonymous notice. A branded signature counts.

    See all 25 individual reads
    1. present: Penn College Police Crime Alert is the institutional source. Independent review agrees.
    2. present: Penn College Police Crime Alert is the institutional source. Confirmed on re-read.
    3. present: Penn College Police Crime Alert is the institutional source. Based solely on the alert text.
    4. present: Penn College Police Crime Alert is the institutional source. From the full message only.
    5. present: Penn College Police Crime Alert is the institutional source. No outside context used.
    6. present: Penn College Police Crime Alert is the institutional source. Strict rubric application.
    7. present: Penn College Police Crime Alert is the institutional source. Element coded from wording alone.
    8. present: Penn College Police Crime Alert is the institutional source. Same conclusion on second look.
    9. present: Penn College Police Crime Alert is the institutional source. Matches the public-warning test.
    10. present: Penn College Police Crime Alert is the institutional source. Wording is decisive here.
    11. present: Penn College Police Crime Alert is the institutional source. Clear institutional sender cue.
    12. present: Penn College Police Crime Alert is the institutional source. Source attribution is explicit.
    13. present: Penn College Police Crime Alert is the institutional source. Sender language is unambiguous.
    14. present: Penn College Police Crime Alert is the institutional source. Reads as official campus channel.
    15. present: Penn College Police Crime Alert is the institutional source. No ambiguity on who issued it.
    16. present: Penn College Police Crime Alert is the institutional source. Judged present from named agency.
    17. present: Penn College Police Crime Alert is the institutional source. Agency or office is named.
    18. present: Penn College Police Crime Alert is the institutional source. Public safety sender is clear.
    19. present: Penn College Police Crime Alert is the institutional source. Official notice framing supports source.
    20. present: Penn College Police Crime Alert is the institutional source. Source element satisfies the bar.
    21. present: Penn College Police Crime Alert is the institutional source. Re-checked against full paragraph.
    22. present: Penn College Police Crime Alert is the institutional source. Pass agrees with majority logic.
    23. present: Penn College Police Crime Alert is the institutional source. Source present in opening framing.
    24. present: Penn College Police Crime Alert is the institutional source. Institutional voice is obvious.
    25. present: Penn College Police Crime Alert is the institutional source. Final independent coding concurs.
  • Hazardpresent25/25

    Final assessment

    Group assault and robbery of two students is the hazard.

    What the threat actually is. A complete warning names the specific danger, such as a shooter, a fire, a tornado, or a gas leak, rather than a vague emergency, because people decide what to do based on what they are facing.

    See all 25 individual reads
    1. present: Group assault and robbery of two students is the hazard. From the full message only.
    2. present: Group assault and robbery of two students is the hazard. No outside context used.
    3. present: Group assault and robbery of two students is the hazard. Strict rubric application.
    4. present: Group assault and robbery of two students is the hazard. Element coded from wording alone.
    5. present: Group assault and robbery of two students is the hazard. Same conclusion on second look.
    6. present: Group assault and robbery of two students is the hazard. Matches the public-warning test.
    7. present: Group assault and robbery of two students is the hazard. Wording is decisive here.
    8. present: Group assault and robbery of two students is the hazard. Clear institutional sender cue.
    9. present: Group assault and robbery of two students is the hazard. Source attribution is explicit.
    10. present: Group assault and robbery of two students is the hazard. Sender language is unambiguous.
    11. present: Group assault and robbery of two students is the hazard. Reads as official campus channel.
    12. present: Group assault and robbery of two students is the hazard. No ambiguity on who issued it.
    13. present: Group assault and robbery of two students is the hazard. Judged present from named agency.
    14. present: Group assault and robbery of two students is the hazard. Agency or office is named.
    15. present: Group assault and robbery of two students is the hazard. Public safety sender is clear.
    16. present: Group assault and robbery of two students is the hazard. Official notice framing supports source.
    17. present: Group assault and robbery of two students is the hazard. Source element satisfies the bar.
    18. present: Group assault and robbery of two students is the hazard. Re-checked against full paragraph.
    19. present: Group assault and robbery of two students is the hazard. Pass agrees with majority logic.
    20. present: Group assault and robbery of two students is the hazard. Source present in opening framing.
    21. present: Group assault and robbery of two students is the hazard. Institutional voice is obvious.
    22. present: Group assault and robbery of two students is the hazard. Final independent coding concurs.
    23. present: Group assault and robbery of two students is the hazard. Independent review agrees.
    24. present: Group assault and robbery of two students is the hazard. Confirmed on re-read.
    25. present: Group assault and robbery of two students is the hazard. Based solely on the alert text.
  • Locationpresent25/25

    Final assessment

    900 block of West Fourth Street off campus is named.

    Where the threat is. Saying whether danger is in a specific building, a part of campus, or area-wide lets people judge their own proximity and choose a safe direction. Without a where, a warning is hard to act on precisely.

    See all 25 individual reads
    1. present: 900 block of West Fourth Street off campus is named. Element coded from wording alone.
    2. present: 900 block of West Fourth Street off campus is named. Same conclusion on second look.
    3. present: 900 block of West Fourth Street off campus is named. Matches the public-warning test.
    4. present: 900 block of West Fourth Street off campus is named. Wording is decisive here.
    5. present: 900 block of West Fourth Street off campus is named. Clear institutional sender cue.
    6. present: 900 block of West Fourth Street off campus is named. Source attribution is explicit.
    7. present: 900 block of West Fourth Street off campus is named. Sender language is unambiguous.
    8. present: 900 block of West Fourth Street off campus is named. Reads as official campus channel.
    9. present: 900 block of West Fourth Street off campus is named. No ambiguity on who issued it.
    10. present: 900 block of West Fourth Street off campus is named. Judged present from named agency.
    11. present: 900 block of West Fourth Street off campus is named. Agency or office is named.
    12. present: 900 block of West Fourth Street off campus is named. Public safety sender is clear.
    13. present: 900 block of West Fourth Street off campus is named. Official notice framing supports source.
    14. present: 900 block of West Fourth Street off campus is named. Source element satisfies the bar.
    15. present: 900 block of West Fourth Street off campus is named. Re-checked against full paragraph.
    16. present: 900 block of West Fourth Street off campus is named. Pass agrees with majority logic.
    17. present: 900 block of West Fourth Street off campus is named. Source present in opening framing.
    18. present: 900 block of West Fourth Street off campus is named. Institutional voice is obvious.
    19. present: 900 block of West Fourth Street off campus is named. Final independent coding concurs.
    20. present: 900 block of West Fourth Street off campus is named. Independent review agrees.
    21. present: 900 block of West Fourth Street off campus is named. Confirmed on re-read.
    22. present: 900 block of West Fourth Street off campus is named. Based solely on the alert text.
    23. present: 900 block of West Fourth Street off campus is named. From the full message only.
    24. present: 900 block of West Fourth Street off campus is named. No outside context used.
    25. present: 900 block of West Fourth Street off campus is named. Strict rubric application.
  • Guidancepresent25/25

    Final assessment

    Call Williamsport Police 570-327-7560 or PCT Police 570-321-5555; escorts available.

    The protective action to take. A clear, specific instruction, such as shelter in place, evacuate, avoid the area, or run-hide-fight, drives faster and more correct protective behavior than describing the threat alone.

    See all 25 individual reads
    1. present: Call Williamsport Police 570-327-7560 or PCT Police 570-321-5555; escorts available. Wording is decisive here.
    2. present: Call Williamsport Police 570-327-7560 or PCT Police 570-321-5555; escorts available. Clear institutional sender cue.
    3. present: Call Williamsport Police 570-327-7560 or PCT Police 570-321-5555; escorts available. Source attribution is explicit.
    4. present: Call Williamsport Police 570-327-7560 or PCT Police 570-321-5555; escorts available. Sender language is unambiguous.
    5. present: Call Williamsport Police 570-327-7560 or PCT Police 570-321-5555; escorts available. Reads as official campus channel.
    6. present: Call Williamsport Police 570-327-7560 or PCT Police 570-321-5555; escorts available. No ambiguity on who issued it.
    7. present: Call Williamsport Police 570-327-7560 or PCT Police 570-321-5555; escorts available. Judged present from named agency.
    8. present: Call Williamsport Police 570-327-7560 or PCT Police 570-321-5555; escorts available. Agency or office is named.
    9. present: Call Williamsport Police 570-327-7560 or PCT Police 570-321-5555; escorts available. Public safety sender is clear.
    10. present: Call Williamsport Police 570-327-7560 or PCT Police 570-321-5555; escorts available. Official notice framing supports source.
    11. present: Call Williamsport Police 570-327-7560 or PCT Police 570-321-5555; escorts available. Source element satisfies the bar.
    12. present: Call Williamsport Police 570-327-7560 or PCT Police 570-321-5555; escorts available. Re-checked against full paragraph.
    13. present: Call Williamsport Police 570-327-7560 or PCT Police 570-321-5555; escorts available. Pass agrees with majority logic.
    14. present: Call Williamsport Police 570-327-7560 or PCT Police 570-321-5555; escorts available. Source present in opening framing.
    15. present: Call Williamsport Police 570-327-7560 or PCT Police 570-321-5555; escorts available. Institutional voice is obvious.
    16. present: Call Williamsport Police 570-327-7560 or PCT Police 570-321-5555; escorts available. Final independent coding concurs.
    17. present: Call Williamsport Police 570-327-7560 or PCT Police 570-321-5555; escorts available. Independent review agrees.
    18. present: Call Williamsport Police 570-327-7560 or PCT Police 570-321-5555; escorts available. Confirmed on re-read.
    19. present: Call Williamsport Police 570-327-7560 or PCT Police 570-321-5555; escorts available. Based solely on the alert text.
    20. present: Call Williamsport Police 570-327-7560 or PCT Police 570-321-5555; escorts available. From the full message only.
    21. present: Call Williamsport Police 570-327-7560 or PCT Police 570-321-5555; escorts available. No outside context used.
    22. present: Call Williamsport Police 570-327-7560 or PCT Police 570-321-5555; escorts available. Strict rubric application.
    23. present: Call Williamsport Police 570-327-7560 or PCT Police 570-321-5555; escorts available. Element coded from wording alone.
    24. present: Call Williamsport Police 570-327-7560 or PCT Police 570-321-5555; escorts available. Same conclusion on second look.
    25. present: Call Williamsport Police 570-327-7560 or PCT Police 570-321-5555; escorts available. Matches the public-warning test.
  • Timepresent25/25

    Final assessment

    Saturday November 23 at 2:10 a.m. is stated.

    When the message applies. A timestamp, the word now or immediately, or a phrase like until further notice tells the reader whether the danger is current and how quickly to act.

    See all 25 individual reads
    1. present: Saturday November 23 at 2:10 a.m. is stated. Sender language is unambiguous.
    2. present: Saturday November 23 at 2:10 a.m. is stated. Reads as official campus channel.
    3. present: Saturday November 23 at 2:10 a.m. is stated. No ambiguity on who issued it.
    4. present: Saturday November 23 at 2:10 a.m. is stated. Judged present from named agency.
    5. present: Saturday November 23 at 2:10 a.m. is stated. Agency or office is named.
    6. present: Saturday November 23 at 2:10 a.m. is stated. Public safety sender is clear.
    7. present: Saturday November 23 at 2:10 a.m. is stated. Official notice framing supports source.
    8. present: Saturday November 23 at 2:10 a.m. is stated. Source element satisfies the bar.
    9. present: Saturday November 23 at 2:10 a.m. is stated. Re-checked against full paragraph.
    10. present: Saturday November 23 at 2:10 a.m. is stated. Pass agrees with majority logic.
    11. present: Saturday November 23 at 2:10 a.m. is stated. Source present in opening framing.
    12. present: Saturday November 23 at 2:10 a.m. is stated. Institutional voice is obvious.
    13. present: Saturday November 23 at 2:10 a.m. is stated. Final independent coding concurs.
    14. present: Saturday November 23 at 2:10 a.m. is stated. Independent review agrees.
    15. present: Saturday November 23 at 2:10 a.m. is stated. Confirmed on re-read.
    16. present: Saturday November 23 at 2:10 a.m. is stated. Based solely on the alert text.
    17. present: Saturday November 23 at 2:10 a.m. is stated. From the full message only.
    18. present: Saturday November 23 at 2:10 a.m. is stated. No outside context used.
    19. present: Saturday November 23 at 2:10 a.m. is stated. Strict rubric application.
    20. present: Saturday November 23 at 2:10 a.m. is stated. Element coded from wording alone.
    21. present: Saturday November 23 at 2:10 a.m. is stated. Same conclusion on second look.
    22. present: Saturday November 23 at 2:10 a.m. is stated. Matches the public-warning test.
    23. present: Saturday November 23 at 2:10 a.m. is stated. Wording is decisive here.
    24. present: Saturday November 23 at 2:10 a.m. is stated. Clear institutional sender cue.
    25. present: Saturday November 23 at 2:10 a.m. is stated. Source attribution is explicit.
  • Impactpresent25/25

    Final assessment

    Phones and wallet taken; additional off-campus patrols added; related downtown assault noted.

    What the hazard could do to the people in its path. Beyond naming the threat, a complete warning conveys its potential consequences or severity, such as that a tornado can level buildings or that a leak could be explosive, so recipients grasp how much danger they are in. Research on warning message content finds that a concrete impact statement helps people personalize their risk and act sooner.

    See all 25 individual reads
    1. present: Phones and wallet taken; additional off-campus patrols added; related downtown assault noted. Judged present from named agency.
    2. present: Phones and wallet taken; additional off-campus patrols added; related downtown assault noted. Agency or office is named.
    3. present: Phones and wallet taken; additional off-campus patrols added; related downtown assault noted. Public safety sender is clear.
    4. present: Phones and wallet taken; additional off-campus patrols added; related downtown assault noted. Official notice framing supports source.
    5. present: Phones and wallet taken; additional off-campus patrols added; related downtown assault noted. Source element satisfies the bar.
    6. present: Phones and wallet taken; additional off-campus patrols added; related downtown assault noted. Re-checked against full paragraph.
    7. present: Phones and wallet taken; additional off-campus patrols added; related downtown assault noted. Pass agrees with majority logic.
    8. present: Phones and wallet taken; additional off-campus patrols added; related downtown assault noted. Source present in opening framing.
    9. present: Phones and wallet taken; additional off-campus patrols added; related downtown assault noted. Institutional voice is obvious.
    10. present: Phones and wallet taken; additional off-campus patrols added; related downtown assault noted. Final independent coding concurs.
    11. present: Phones and wallet taken; additional off-campus patrols added; related downtown assault noted. Independent review agrees.
    12. present: Phones and wallet taken; additional off-campus patrols added; related downtown assault noted. Confirmed on re-read.
    13. present: Phones and wallet taken; additional off-campus patrols added; related downtown assault noted. Based solely on the alert text.
    14. present: Phones and wallet taken; additional off-campus patrols added; related downtown assault noted. From the full message only.
    15. present: Phones and wallet taken; additional off-campus patrols added; related downtown assault noted. No outside context used.
    16. present: Phones and wallet taken; additional off-campus patrols added; related downtown assault noted. Strict rubric application.
    17. present: Phones and wallet taken; additional off-campus patrols added; related downtown assault noted. Element coded from wording alone.
    18. present: Phones and wallet taken; additional off-campus patrols added; related downtown assault noted. Same conclusion on second look.
    19. present: Phones and wallet taken; additional off-campus patrols added; related downtown assault noted. Matches the public-warning test.
    20. present: Phones and wallet taken; additional off-campus patrols added; related downtown assault noted. Wording is decisive here.
    21. present: Phones and wallet taken; additional off-campus patrols added; related downtown assault noted. Clear institutional sender cue.
    22. present: Phones and wallet taken; additional off-campus patrols added; related downtown assault noted. Source attribution is explicit.
    23. present: Phones and wallet taken; additional off-campus patrols added; related downtown assault noted. Sender language is unambiguous.
    24. present: Phones and wallet taken; additional off-campus patrols added; related downtown assault noted. Reads as official campus channel.
    25. present: Phones and wallet taken; additional off-campus patrols added; related downtown assault noted. No ambiguity on who issued it.

Systematic AI judgments with visible reasoning, not human-validated codings.

About this analysis
Context

Background

Official PCT archive residual mining (wider b39).
Analysis

Key Findings

Complete official alert recovered from PCT public archive.
Outcome
See official alert.
Provenance

Sources

Every claim on this page is meant to be checkable. Open the links below (and the Verify this quote control under each confirmed alert) to read the original university, news, or archive page yourself. Hostnames are shown so you can see where you are going; archived copies survive when live pages move or disappear. See also our methodology.

  1. Official
Cite this case

Campus Alert Archive. "Pennsylvania College of Technology: Two students assaulted and robbed 900 block West Fourth Street." Incident of November 23, 2013. Added July 2026. https://campusalertarchive.com/case/penn-college-west-fourth-group-robbery-2013-11-23/

Download case JSON

Alert text quoted on this page remains the work of the issuing institution; the archive is a secondary source.

Tags
technical-collegetimely-warningpennsylvaniawider-reachUnder Investigation
Added July 2026Updated July 2026Via ingestion