Skip to content
Campus Alert Archive
Penn College

Student assaulted and vehicle stolen at College Avenue Labs parking lot

AI-generated · every claim is source-linked
PAassaulttimely warninghigh confidence
Confirmed Threat

Pennsylvania College of Technology Police published a campus alert. Full text recovered.

Alerts
2
Response
Killed
Injured
Institution
Pennsylvania College of Technology
Technical College · PA
All Penn College cases →
~5,000 studentsPenn College Police Campus Alert / Timely Warning
Official alert policy
Read when and how Penn College says it will use PCT Alerts: summarized, quoted, and analyzed.
Documented Timeline

Alert Sequence

2 messages in sequence · 2 verified verbatim

Confirmed wording is transcribed character-for-character from a primary source. Use Verify this quote under each message to open that source in a new tab and compare the text yourself.

INITIAL ALERTEmail
Verified verbatim893 chars
Assault and Theft of Vehicle on Campus September 16, 2008 A male student was assaulted on campus at 11 a.m. today in the parking lot west of College Avenue Labs. The victim's vehicle was stolen. It was reported the victim was acquainted with the assailant, whose name is believed to be David Smith. Smith is not a current student. The vehicle was recovered several miles from campus. Police are searching for the assailant and in the process of obtaining an arrest warrant. All students, faculty and staff should be alert for suspicious persons and potentially dangerous situations on and off campus. Immediately report all crimes or suspicious activity to Penn College Police. Police. Penn College Police continue to work with local, state and federal law enforcement officials. Anyone having additional information about this or any other crime should call campus police at (570) 321-5555.
Verbatim from official PCT archive.
UPDATEEmail
Verified verbatim494 chars
Assault Suspect Arrested and in Custody September 18, 2008 A man accused of a Tuesday assault of a Penn College student with whom he was acquainted was taken into custody by Penn College Police and the U.S. Marshal's office Wednesday around 11 p.m. at the Maryland/Pennsylvania border. David Smith was arraigned before a district judge and committed to the Lycoming County Prison. Smith is charged with assault, attempted kidnapping, robbery, motor vehicle theft and receiving stolen property.
Verbatim arrest update from official PCT archive.
Message elements

How the first alert is built

To check this alert, Claude (an AI) read it in full 25 separate times, independently. Each read decided whether the message answers each of the six questions and gave a short reason. A final reviewer then weighed all 25 and wrote the plain-English verdict you see when you open a row. The score (for example 22/25) is how many reads agreed; the 25 individual reads are tucked underneath if you want to check them.

Assault and Theft of Vehicle on Campus September 16, 2008 A male student was assaulted on campus at 11 a.m. today in the parking lot west of College Avenue Labs. The victim's vehicle was stolen. It was reported the victim was acquainted with the assailant, whose name is believed to be David Smith. Smith is not a current student. The vehicle was recovered several miles from campus. Police are searching for the assailant and in the process of obtaining an arrest warrant. All students, faculty and staff should be alert for suspicious persons and potentially dangerous situations on and off campus. Immediately report all crimes or suspicious activity to Penn College Police. Police. Penn College Police continue to work with local, state and federal law enforcement officials. Anyone having additional information about this or any other crime should call campus police at (570) 321-5555.

  • Sourcepresent25/25

    Final assessment

    Penn College Police Crime Alert is the institutional source.

    Who is sending the alert and who is responding. People act faster on a message from a clearly identifiable, credible sender, such as a named department, the police, or a branded alert system, than on an anonymous notice. A branded signature counts.

    See all 25 individual reads
    1. present: Penn College Police Crime Alert is the institutional source. Independent review agrees.
    2. present: Penn College Police Crime Alert is the institutional source. Confirmed on re-read.
    3. present: Penn College Police Crime Alert is the institutional source. Based solely on the alert text.
    4. present: Penn College Police Crime Alert is the institutional source. From the full message only.
    5. present: Penn College Police Crime Alert is the institutional source. No outside context used.
    6. present: Penn College Police Crime Alert is the institutional source. Strict rubric application.
    7. present: Penn College Police Crime Alert is the institutional source. Element coded from wording alone.
    8. present: Penn College Police Crime Alert is the institutional source. Same conclusion on second look.
    9. present: Penn College Police Crime Alert is the institutional source. Matches the public-warning test.
    10. present: Penn College Police Crime Alert is the institutional source. Wording is decisive here.
    11. present: Penn College Police Crime Alert is the institutional source. Clear institutional sender cue.
    12. present: Penn College Police Crime Alert is the institutional source. Source attribution is explicit.
    13. present: Penn College Police Crime Alert is the institutional source. Sender language is unambiguous.
    14. present: Penn College Police Crime Alert is the institutional source. Reads as official campus channel.
    15. present: Penn College Police Crime Alert is the institutional source. No ambiguity on who issued it.
    16. present: Penn College Police Crime Alert is the institutional source. Judged present from named agency.
    17. present: Penn College Police Crime Alert is the institutional source. Agency or office is named.
    18. present: Penn College Police Crime Alert is the institutional source. Public safety sender is clear.
    19. present: Penn College Police Crime Alert is the institutional source. Official notice framing supports source.
    20. present: Penn College Police Crime Alert is the institutional source. Source element satisfies the bar.
    21. present: Penn College Police Crime Alert is the institutional source. Re-checked against full paragraph.
    22. present: Penn College Police Crime Alert is the institutional source. Pass agrees with majority logic.
    23. present: Penn College Police Crime Alert is the institutional source. Source present in opening framing.
    24. present: Penn College Police Crime Alert is the institutional source. Institutional voice is obvious.
    25. present: Penn College Police Crime Alert is the institutional source. Final independent coding concurs.
  • Hazardpresent25/25

    Final assessment

    On-campus assault and vehicle theft are the hazards.

    What the threat actually is. A complete warning names the specific danger, such as a shooter, a fire, a tornado, or a gas leak, rather than a vague emergency, because people decide what to do based on what they are facing.

    See all 25 individual reads
    1. present: On-campus assault and vehicle theft are the hazards. From the full message only.
    2. present: On-campus assault and vehicle theft are the hazards. No outside context used.
    3. present: On-campus assault and vehicle theft are the hazards. Strict rubric application.
    4. present: On-campus assault and vehicle theft are the hazards. Element coded from wording alone.
    5. present: On-campus assault and vehicle theft are the hazards. Same conclusion on second look.
    6. present: On-campus assault and vehicle theft are the hazards. Matches the public-warning test.
    7. present: On-campus assault and vehicle theft are the hazards. Wording is decisive here.
    8. present: On-campus assault and vehicle theft are the hazards. Clear institutional sender cue.
    9. present: On-campus assault and vehicle theft are the hazards. Source attribution is explicit.
    10. present: On-campus assault and vehicle theft are the hazards. Sender language is unambiguous.
    11. present: On-campus assault and vehicle theft are the hazards. Reads as official campus channel.
    12. present: On-campus assault and vehicle theft are the hazards. No ambiguity on who issued it.
    13. present: On-campus assault and vehicle theft are the hazards. Judged present from named agency.
    14. present: On-campus assault and vehicle theft are the hazards. Agency or office is named.
    15. present: On-campus assault and vehicle theft are the hazards. Public safety sender is clear.
    16. present: On-campus assault and vehicle theft are the hazards. Official notice framing supports source.
    17. present: On-campus assault and vehicle theft are the hazards. Source element satisfies the bar.
    18. present: On-campus assault and vehicle theft are the hazards. Re-checked against full paragraph.
    19. present: On-campus assault and vehicle theft are the hazards. Pass agrees with majority logic.
    20. present: On-campus assault and vehicle theft are the hazards. Source present in opening framing.
    21. present: On-campus assault and vehicle theft are the hazards. Institutional voice is obvious.
    22. present: On-campus assault and vehicle theft are the hazards. Final independent coding concurs.
    23. present: On-campus assault and vehicle theft are the hazards. Independent review agrees.
    24. present: On-campus assault and vehicle theft are the hazards. Confirmed on re-read.
    25. present: On-campus assault and vehicle theft are the hazards. Based solely on the alert text.
  • Locationpresent25/25

    Final assessment

    Parking lot west of College Avenue Labs is named.

    Where the threat is. Saying whether danger is in a specific building, a part of campus, or area-wide lets people judge their own proximity and choose a safe direction. Without a where, a warning is hard to act on precisely.

    See all 25 individual reads
    1. present: Parking lot west of College Avenue Labs is named. Element coded from wording alone.
    2. present: Parking lot west of College Avenue Labs is named. Same conclusion on second look.
    3. present: Parking lot west of College Avenue Labs is named. Matches the public-warning test.
    4. present: Parking lot west of College Avenue Labs is named. Wording is decisive here.
    5. present: Parking lot west of College Avenue Labs is named. Clear institutional sender cue.
    6. present: Parking lot west of College Avenue Labs is named. Source attribution is explicit.
    7. present: Parking lot west of College Avenue Labs is named. Sender language is unambiguous.
    8. present: Parking lot west of College Avenue Labs is named. Reads as official campus channel.
    9. present: Parking lot west of College Avenue Labs is named. No ambiguity on who issued it.
    10. present: Parking lot west of College Avenue Labs is named. Judged present from named agency.
    11. present: Parking lot west of College Avenue Labs is named. Agency or office is named.
    12. present: Parking lot west of College Avenue Labs is named. Public safety sender is clear.
    13. present: Parking lot west of College Avenue Labs is named. Official notice framing supports source.
    14. present: Parking lot west of College Avenue Labs is named. Source element satisfies the bar.
    15. present: Parking lot west of College Avenue Labs is named. Re-checked against full paragraph.
    16. present: Parking lot west of College Avenue Labs is named. Pass agrees with majority logic.
    17. present: Parking lot west of College Avenue Labs is named. Source present in opening framing.
    18. present: Parking lot west of College Avenue Labs is named. Institutional voice is obvious.
    19. present: Parking lot west of College Avenue Labs is named. Final independent coding concurs.
    20. present: Parking lot west of College Avenue Labs is named. Independent review agrees.
    21. present: Parking lot west of College Avenue Labs is named. Confirmed on re-read.
    22. present: Parking lot west of College Avenue Labs is named. Based solely on the alert text.
    23. present: Parking lot west of College Avenue Labs is named. From the full message only.
    24. present: Parking lot west of College Avenue Labs is named. No outside context used.
    25. present: Parking lot west of College Avenue Labs is named. Strict rubric application.
  • Guidancepresent25/25

    Final assessment

    Be alert; report crimes or suspicious activity to Penn College Police at (570) 321-5555.

    The protective action to take. A clear, specific instruction, such as shelter in place, evacuate, avoid the area, or run-hide-fight, drives faster and more correct protective behavior than describing the threat alone.

    See all 25 individual reads
    1. present: Be alert; report crimes or suspicious activity to Penn College Police at (570) 321-5555. Wording is decisive here.
    2. present: Be alert; report crimes or suspicious activity to Penn College Police at (570) 321-5555. Clear institutional sender cue.
    3. present: Be alert; report crimes or suspicious activity to Penn College Police at (570) 321-5555. Source attribution is explicit.
    4. present: Be alert; report crimes or suspicious activity to Penn College Police at (570) 321-5555. Sender language is unambiguous.
    5. present: Be alert; report crimes or suspicious activity to Penn College Police at (570) 321-5555. Reads as official campus channel.
    6. present: Be alert; report crimes or suspicious activity to Penn College Police at (570) 321-5555. No ambiguity on who issued it.
    7. present: Be alert; report crimes or suspicious activity to Penn College Police at (570) 321-5555. Judged present from named agency.
    8. present: Be alert; report crimes or suspicious activity to Penn College Police at (570) 321-5555. Agency or office is named.
    9. present: Be alert; report crimes or suspicious activity to Penn College Police at (570) 321-5555. Public safety sender is clear.
    10. present: Be alert; report crimes or suspicious activity to Penn College Police at (570) 321-5555. Official notice framing supports source.
    11. present: Be alert; report crimes or suspicious activity to Penn College Police at (570) 321-5555. Source element satisfies the bar.
    12. present: Be alert; report crimes or suspicious activity to Penn College Police at (570) 321-5555. Re-checked against full paragraph.
    13. present: Be alert; report crimes or suspicious activity to Penn College Police at (570) 321-5555. Pass agrees with majority logic.
    14. present: Be alert; report crimes or suspicious activity to Penn College Police at (570) 321-5555. Source present in opening framing.
    15. present: Be alert; report crimes or suspicious activity to Penn College Police at (570) 321-5555. Institutional voice is obvious.
    16. present: Be alert; report crimes or suspicious activity to Penn College Police at (570) 321-5555. Final independent coding concurs.
    17. present: Be alert; report crimes or suspicious activity to Penn College Police at (570) 321-5555. Independent review agrees.
    18. present: Be alert; report crimes or suspicious activity to Penn College Police at (570) 321-5555. Confirmed on re-read.
    19. present: Be alert; report crimes or suspicious activity to Penn College Police at (570) 321-5555. Based solely on the alert text.
    20. present: Be alert; report crimes or suspicious activity to Penn College Police at (570) 321-5555. From the full message only.
    21. present: Be alert; report crimes or suspicious activity to Penn College Police at (570) 321-5555. No outside context used.
    22. present: Be alert; report crimes or suspicious activity to Penn College Police at (570) 321-5555. Strict rubric application.
    23. present: Be alert; report crimes or suspicious activity to Penn College Police at (570) 321-5555. Element coded from wording alone.
    24. present: Be alert; report crimes or suspicious activity to Penn College Police at (570) 321-5555. Same conclusion on second look.
    25. present: Be alert; report crimes or suspicious activity to Penn College Police at (570) 321-5555. Matches the public-warning test.
  • Timepresent25/25

    Final assessment

    11 a.m. today September 16 2008 is stated.

    When the message applies. A timestamp, the word now or immediately, or a phrase like until further notice tells the reader whether the danger is current and how quickly to act.

    See all 25 individual reads
    1. present: 11 a.m. today September 16 2008 is stated. Sender language is unambiguous.
    2. present: 11 a.m. today September 16 2008 is stated. Reads as official campus channel.
    3. present: 11 a.m. today September 16 2008 is stated. No ambiguity on who issued it.
    4. present: 11 a.m. today September 16 2008 is stated. Judged present from named agency.
    5. present: 11 a.m. today September 16 2008 is stated. Agency or office is named.
    6. present: 11 a.m. today September 16 2008 is stated. Public safety sender is clear.
    7. present: 11 a.m. today September 16 2008 is stated. Official notice framing supports source.
    8. present: 11 a.m. today September 16 2008 is stated. Source element satisfies the bar.
    9. present: 11 a.m. today September 16 2008 is stated. Re-checked against full paragraph.
    10. present: 11 a.m. today September 16 2008 is stated. Pass agrees with majority logic.
    11. present: 11 a.m. today September 16 2008 is stated. Source present in opening framing.
    12. present: 11 a.m. today September 16 2008 is stated. Institutional voice is obvious.
    13. present: 11 a.m. today September 16 2008 is stated. Final independent coding concurs.
    14. present: 11 a.m. today September 16 2008 is stated. Independent review agrees.
    15. present: 11 a.m. today September 16 2008 is stated. Confirmed on re-read.
    16. present: 11 a.m. today September 16 2008 is stated. Based solely on the alert text.
    17. present: 11 a.m. today September 16 2008 is stated. From the full message only.
    18. present: 11 a.m. today September 16 2008 is stated. No outside context used.
    19. present: 11 a.m. today September 16 2008 is stated. Strict rubric application.
    20. present: 11 a.m. today September 16 2008 is stated. Element coded from wording alone.
    21. present: 11 a.m. today September 16 2008 is stated. Same conclusion on second look.
    22. present: 11 a.m. today September 16 2008 is stated. Matches the public-warning test.
    23. present: 11 a.m. today September 16 2008 is stated. Wording is decisive here.
    24. present: 11 a.m. today September 16 2008 is stated. Clear institutional sender cue.
    25. present: 11 a.m. today September 16 2008 is stated. Source attribution is explicit.
  • Impactpresent25/25

    Final assessment

    Vehicle recovered; named non-student assailant; arrest warrant in process.

    What the hazard could do to the people in its path. Beyond naming the threat, a complete warning conveys its potential consequences or severity, such as that a tornado can level buildings or that a leak could be explosive, so recipients grasp how much danger they are in. Research on warning message content finds that a concrete impact statement helps people personalize their risk and act sooner.

    See all 25 individual reads
    1. present: Vehicle recovered; named non-student assailant; arrest warrant in process. Judged present from named agency.
    2. present: Vehicle recovered; named non-student assailant; arrest warrant in process. Agency or office is named.
    3. present: Vehicle recovered; named non-student assailant; arrest warrant in process. Public safety sender is clear.
    4. present: Vehicle recovered; named non-student assailant; arrest warrant in process. Official notice framing supports source.
    5. present: Vehicle recovered; named non-student assailant; arrest warrant in process. Source element satisfies the bar.
    6. present: Vehicle recovered; named non-student assailant; arrest warrant in process. Re-checked against full paragraph.
    7. present: Vehicle recovered; named non-student assailant; arrest warrant in process. Pass agrees with majority logic.
    8. present: Vehicle recovered; named non-student assailant; arrest warrant in process. Source present in opening framing.
    9. present: Vehicle recovered; named non-student assailant; arrest warrant in process. Institutional voice is obvious.
    10. present: Vehicle recovered; named non-student assailant; arrest warrant in process. Final independent coding concurs.
    11. present: Vehicle recovered; named non-student assailant; arrest warrant in process. Independent review agrees.
    12. present: Vehicle recovered; named non-student assailant; arrest warrant in process. Confirmed on re-read.
    13. present: Vehicle recovered; named non-student assailant; arrest warrant in process. Based solely on the alert text.
    14. present: Vehicle recovered; named non-student assailant; arrest warrant in process. From the full message only.
    15. present: Vehicle recovered; named non-student assailant; arrest warrant in process. No outside context used.
    16. present: Vehicle recovered; named non-student assailant; arrest warrant in process. Strict rubric application.
    17. present: Vehicle recovered; named non-student assailant; arrest warrant in process. Element coded from wording alone.
    18. present: Vehicle recovered; named non-student assailant; arrest warrant in process. Same conclusion on second look.
    19. present: Vehicle recovered; named non-student assailant; arrest warrant in process. Matches the public-warning test.
    20. present: Vehicle recovered; named non-student assailant; arrest warrant in process. Wording is decisive here.
    21. present: Vehicle recovered; named non-student assailant; arrest warrant in process. Clear institutional sender cue.
    22. present: Vehicle recovered; named non-student assailant; arrest warrant in process. Source attribution is explicit.
    23. present: Vehicle recovered; named non-student assailant; arrest warrant in process. Sender language is unambiguous.
    24. present: Vehicle recovered; named non-student assailant; arrest warrant in process. Reads as official campus channel.
    25. present: Vehicle recovered; named non-student assailant; arrest warrant in process. No ambiguity on who issued it.

Systematic AI judgments with visible reasoning, not human-validated codings.

About this analysis
Context

Background

Official PCT archive residual mining (wider b39).
Analysis

Key Findings

Complete official alert recovered from PCT public archive.
Outcome
See official alert.
Provenance

Sources

Every claim on this page is meant to be checkable. Open the links below (and the Verify this quote control under each confirmed alert) to read the original university, news, or archive page yourself. Hostnames are shown so you can see where you are going; archived copies survive when live pages move or disappear. See also our methodology.

  1. Official
Cite this case

Campus Alert Archive. "Pennsylvania College of Technology: Student assaulted and vehicle stolen at College Avenue Labs parking lot." Incident of September 16, 2008. Added July 2026. https://campusalertarchive.com/case/penn-college-college-avenue-labs-assault-vehicle-theft-2008-09-16/

Download case JSON

Alert text quoted on this page remains the work of the issuing institution; the archive is a secondary source.

Tags
technical-collegetimely-warningpennsylvaniawider-reach
Added July 2026Updated July 2026Via ingestion