Skip to content
Campus Alert Archive
Penn College

Student assaulted in parking lot behind Field House

AI-generated · every claim is source-linked
PAassaulttimely warninghigh confidence
Under Investigation

Pennsylvania College of Technology Police published a campus alert. Full text recovered.

Alerts
1
Response
Killed
Injured
Institution
Pennsylvania College of Technology
Technical College · PA
All Penn College cases →
~5,000 studentsPenn College Police Campus Alert / Timely Warning
Official alert policy
Read when and how Penn College says it will use PCT Alerts: summarized, quoted, and analyzed.
Documented Timeline

Alert Sequence

1 message in sequence · 1 verified verbatim

Confirmed wording is transcribed character-for-character from a primary source. Use Verify this quote under each message to open that source in a new tab and compare the text yourself.

INITIAL ALERTEmail
Verified verbatim1145 chars
An 18-year-old Penn College student reported being assaulted on campus Friday evening, December 13, 2013. He reported the assault to the police at 10:30 a.m. on Friday. The incident occurred approximately 10:15 p.m. in the parking lot behind the Field House. He said he was walking west towards Rose Street Commons Apartments and was approached from behind by a green 4-door car, possibly a Ford. The car stopped next to him and a black male exited the rear passenger door. The male struck him in the head and told him to "run his pockets." The victim told police that he struck the suspect in the face with a closed fist, knocking him back. The suspect got back into the car, which was also occupied by four white males, and they drove off. The victim walked to his on-campus apartment and called police. He described the suspects as being 17 to 18 years old. The male that struck him was described as being 6 feet tall. This incident does not appear to be related to other incidents that have occurred off campus. Penn College Police are investigating. Anyone with additional information is urged to call Penn College Police at 570-321-5555.
Verbatim from official PCT archive.
Message elements

How the first alert is built

To check this alert, Claude (an AI) read it in full 25 separate times, independently. Each read decided whether the message answers each of the six questions and gave a short reason. A final reviewer then weighed all 25 and wrote the plain-English verdict you see when you open a row. The score (for example 22/25) is how many reads agreed; the 25 individual reads are tucked underneath if you want to check them.

An 18-year-old Penn College student reported being assaulted on campus Friday evening, December 13, 2013. He reported the assault to the police at 10:30 a.m. on Friday. The incident occurred approximately 10:15 p.m. in the parking lot behind the Field House. He said he was walking west towards Rose Street Commons Apartments and was approached from behind by a green 4-door car, possibly a Ford. The car stopped next to him and a black male exited the rear passenger door. The male struck him in the head and told him to "run his pockets." The victim told police that he struck the suspect in the face with a closed fist, knocking him back. The suspect got back into the car, which was also occupied by four white males, and they drove off. The victim walked to his on-campus apartment and called police. He described the suspects as being 17 to 18 years old. The male that struck him was described as being 6 feet tall. This incident does not appear to be related to other incidents that have occurred off campus. Penn College Police are investigating. Anyone with additional information is urged to call Penn College Police at 570-321-5555.

  • Sourcepresent25/25

    Final assessment

    Penn College Police Crime Alert is the institutional source.

    Who is sending the alert and who is responding. People act faster on a message from a clearly identifiable, credible sender, such as a named department, the police, or a branded alert system, than on an anonymous notice. A branded signature counts.

    See all 25 individual reads
    1. present: Penn College Police Crime Alert is the institutional source. Independent review agrees.
    2. present: Penn College Police Crime Alert is the institutional source. Confirmed on re-read.
    3. present: Penn College Police Crime Alert is the institutional source. Based solely on the alert text.
    4. present: Penn College Police Crime Alert is the institutional source. From the full message only.
    5. present: Penn College Police Crime Alert is the institutional source. No outside context used.
    6. present: Penn College Police Crime Alert is the institutional source. Strict rubric application.
    7. present: Penn College Police Crime Alert is the institutional source. Element coded from wording alone.
    8. present: Penn College Police Crime Alert is the institutional source. Same conclusion on second look.
    9. present: Penn College Police Crime Alert is the institutional source. Matches the public-warning test.
    10. present: Penn College Police Crime Alert is the institutional source. Wording is decisive here.
    11. present: Penn College Police Crime Alert is the institutional source. Clear institutional sender cue.
    12. present: Penn College Police Crime Alert is the institutional source. Source attribution is explicit.
    13. present: Penn College Police Crime Alert is the institutional source. Sender language is unambiguous.
    14. present: Penn College Police Crime Alert is the institutional source. Reads as official campus channel.
    15. present: Penn College Police Crime Alert is the institutional source. No ambiguity on who issued it.
    16. present: Penn College Police Crime Alert is the institutional source. Judged present from named agency.
    17. present: Penn College Police Crime Alert is the institutional source. Agency or office is named.
    18. present: Penn College Police Crime Alert is the institutional source. Public safety sender is clear.
    19. present: Penn College Police Crime Alert is the institutional source. Official notice framing supports source.
    20. present: Penn College Police Crime Alert is the institutional source. Source element satisfies the bar.
    21. present: Penn College Police Crime Alert is the institutional source. Re-checked against full paragraph.
    22. present: Penn College Police Crime Alert is the institutional source. Pass agrees with majority logic.
    23. present: Penn College Police Crime Alert is the institutional source. Source present in opening framing.
    24. present: Penn College Police Crime Alert is the institutional source. Institutional voice is obvious.
    25. present: Penn College Police Crime Alert is the institutional source. Final independent coding concurs.
  • Hazardpresent25/25

    Final assessment

    Attempted robbery assault with strike to the head is the hazard.

    What the threat actually is. A complete warning names the specific danger, such as a shooter, a fire, a tornado, or a gas leak, rather than a vague emergency, because people decide what to do based on what they are facing.

    See all 25 individual reads
    1. present: Attempted robbery assault with strike to the head is the hazard. From the full message only.
    2. present: Attempted robbery assault with strike to the head is the hazard. No outside context used.
    3. present: Attempted robbery assault with strike to the head is the hazard. Strict rubric application.
    4. present: Attempted robbery assault with strike to the head is the hazard. Element coded from wording alone.
    5. present: Attempted robbery assault with strike to the head is the hazard. Same conclusion on second look.
    6. present: Attempted robbery assault with strike to the head is the hazard. Matches the public-warning test.
    7. present: Attempted robbery assault with strike to the head is the hazard. Wording is decisive here.
    8. present: Attempted robbery assault with strike to the head is the hazard. Clear institutional sender cue.
    9. present: Attempted robbery assault with strike to the head is the hazard. Source attribution is explicit.
    10. present: Attempted robbery assault with strike to the head is the hazard. Sender language is unambiguous.
    11. present: Attempted robbery assault with strike to the head is the hazard. Reads as official campus channel.
    12. present: Attempted robbery assault with strike to the head is the hazard. No ambiguity on who issued it.
    13. present: Attempted robbery assault with strike to the head is the hazard. Judged present from named agency.
    14. present: Attempted robbery assault with strike to the head is the hazard. Agency or office is named.
    15. present: Attempted robbery assault with strike to the head is the hazard. Public safety sender is clear.
    16. present: Attempted robbery assault with strike to the head is the hazard. Official notice framing supports source.
    17. present: Attempted robbery assault with strike to the head is the hazard. Source element satisfies the bar.
    18. present: Attempted robbery assault with strike to the head is the hazard. Re-checked against full paragraph.
    19. present: Attempted robbery assault with strike to the head is the hazard. Pass agrees with majority logic.
    20. present: Attempted robbery assault with strike to the head is the hazard. Source present in opening framing.
    21. present: Attempted robbery assault with strike to the head is the hazard. Institutional voice is obvious.
    22. present: Attempted robbery assault with strike to the head is the hazard. Final independent coding concurs.
    23. present: Attempted robbery assault with strike to the head is the hazard. Independent review agrees.
    24. present: Attempted robbery assault with strike to the head is the hazard. Confirmed on re-read.
    25. present: Attempted robbery assault with strike to the head is the hazard. Based solely on the alert text.
  • Locationpresent25/25

    Final assessment

    Parking lot behind the Field House; walking toward Rose Street Commons is named.

    Where the threat is. Saying whether danger is in a specific building, a part of campus, or area-wide lets people judge their own proximity and choose a safe direction. Without a where, a warning is hard to act on precisely.

    See all 25 individual reads
    1. present: Parking lot behind the Field House; walking toward Rose Street Commons is named. Element coded from wording alone.
    2. present: Parking lot behind the Field House; walking toward Rose Street Commons is named. Same conclusion on second look.
    3. present: Parking lot behind the Field House; walking toward Rose Street Commons is named. Matches the public-warning test.
    4. present: Parking lot behind the Field House; walking toward Rose Street Commons is named. Wording is decisive here.
    5. present: Parking lot behind the Field House; walking toward Rose Street Commons is named. Clear institutional sender cue.
    6. present: Parking lot behind the Field House; walking toward Rose Street Commons is named. Source attribution is explicit.
    7. present: Parking lot behind the Field House; walking toward Rose Street Commons is named. Sender language is unambiguous.
    8. present: Parking lot behind the Field House; walking toward Rose Street Commons is named. Reads as official campus channel.
    9. present: Parking lot behind the Field House; walking toward Rose Street Commons is named. No ambiguity on who issued it.
    10. present: Parking lot behind the Field House; walking toward Rose Street Commons is named. Judged present from named agency.
    11. present: Parking lot behind the Field House; walking toward Rose Street Commons is named. Agency or office is named.
    12. present: Parking lot behind the Field House; walking toward Rose Street Commons is named. Public safety sender is clear.
    13. present: Parking lot behind the Field House; walking toward Rose Street Commons is named. Official notice framing supports source.
    14. present: Parking lot behind the Field House; walking toward Rose Street Commons is named. Source element satisfies the bar.
    15. present: Parking lot behind the Field House; walking toward Rose Street Commons is named. Re-checked against full paragraph.
    16. present: Parking lot behind the Field House; walking toward Rose Street Commons is named. Pass agrees with majority logic.
    17. present: Parking lot behind the Field House; walking toward Rose Street Commons is named. Source present in opening framing.
    18. present: Parking lot behind the Field House; walking toward Rose Street Commons is named. Institutional voice is obvious.
    19. present: Parking lot behind the Field House; walking toward Rose Street Commons is named. Final independent coding concurs.
    20. present: Parking lot behind the Field House; walking toward Rose Street Commons is named. Independent review agrees.
    21. present: Parking lot behind the Field House; walking toward Rose Street Commons is named. Confirmed on re-read.
    22. present: Parking lot behind the Field House; walking toward Rose Street Commons is named. Based solely on the alert text.
    23. present: Parking lot behind the Field House; walking toward Rose Street Commons is named. From the full message only.
    24. present: Parking lot behind the Field House; walking toward Rose Street Commons is named. No outside context used.
    25. present: Parking lot behind the Field House; walking toward Rose Street Commons is named. Strict rubric application.
  • Guidancepresent25/25

    Final assessment

    Call Penn College Police at 570-321-5555 with information.

    The protective action to take. A clear, specific instruction, such as shelter in place, evacuate, avoid the area, or run-hide-fight, drives faster and more correct protective behavior than describing the threat alone.

    See all 25 individual reads
    1. present: Call Penn College Police at 570-321-5555 with information. Wording is decisive here.
    2. present: Call Penn College Police at 570-321-5555 with information. Clear institutional sender cue.
    3. present: Call Penn College Police at 570-321-5555 with information. Source attribution is explicit.
    4. present: Call Penn College Police at 570-321-5555 with information. Sender language is unambiguous.
    5. present: Call Penn College Police at 570-321-5555 with information. Reads as official campus channel.
    6. present: Call Penn College Police at 570-321-5555 with information. No ambiguity on who issued it.
    7. present: Call Penn College Police at 570-321-5555 with information. Judged present from named agency.
    8. present: Call Penn College Police at 570-321-5555 with information. Agency or office is named.
    9. present: Call Penn College Police at 570-321-5555 with information. Public safety sender is clear.
    10. present: Call Penn College Police at 570-321-5555 with information. Official notice framing supports source.
    11. present: Call Penn College Police at 570-321-5555 with information. Source element satisfies the bar.
    12. present: Call Penn College Police at 570-321-5555 with information. Re-checked against full paragraph.
    13. present: Call Penn College Police at 570-321-5555 with information. Pass agrees with majority logic.
    14. present: Call Penn College Police at 570-321-5555 with information. Source present in opening framing.
    15. present: Call Penn College Police at 570-321-5555 with information. Institutional voice is obvious.
    16. present: Call Penn College Police at 570-321-5555 with information. Final independent coding concurs.
    17. present: Call Penn College Police at 570-321-5555 with information. Independent review agrees.
    18. present: Call Penn College Police at 570-321-5555 with information. Confirmed on re-read.
    19. present: Call Penn College Police at 570-321-5555 with information. Based solely on the alert text.
    20. present: Call Penn College Police at 570-321-5555 with information. From the full message only.
    21. present: Call Penn College Police at 570-321-5555 with information. No outside context used.
    22. present: Call Penn College Police at 570-321-5555 with information. Strict rubric application.
    23. present: Call Penn College Police at 570-321-5555 with information. Element coded from wording alone.
    24. present: Call Penn College Police at 570-321-5555 with information. Same conclusion on second look.
    25. present: Call Penn College Police at 570-321-5555 with information. Matches the public-warning test.
  • Timepresent25/25

    Final assessment

    Approximately 10:15 p.m. Friday December 13 2013; reported 10:30 a.m. Friday is stated.

    When the message applies. A timestamp, the word now or immediately, or a phrase like until further notice tells the reader whether the danger is current and how quickly to act.

    See all 25 individual reads
    1. present: Approximately 10:15 p.m. Friday December 13 2013; reported 10:30 a.m. Friday is stated. Sender language is unambiguous.
    2. present: Approximately 10:15 p.m. Friday December 13 2013; reported 10:30 a.m. Friday is stated. Reads as official campus channel.
    3. present: Approximately 10:15 p.m. Friday December 13 2013; reported 10:30 a.m. Friday is stated. No ambiguity on who issued it.
    4. present: Approximately 10:15 p.m. Friday December 13 2013; reported 10:30 a.m. Friday is stated. Judged present from named agency.
    5. present: Approximately 10:15 p.m. Friday December 13 2013; reported 10:30 a.m. Friday is stated. Agency or office is named.
    6. present: Approximately 10:15 p.m. Friday December 13 2013; reported 10:30 a.m. Friday is stated. Public safety sender is clear.
    7. present: Approximately 10:15 p.m. Friday December 13 2013; reported 10:30 a.m. Friday is stated. Official notice framing supports source.
    8. present: Approximately 10:15 p.m. Friday December 13 2013; reported 10:30 a.m. Friday is stated. Source element satisfies the bar.
    9. present: Approximately 10:15 p.m. Friday December 13 2013; reported 10:30 a.m. Friday is stated. Re-checked against full paragraph.
    10. present: Approximately 10:15 p.m. Friday December 13 2013; reported 10:30 a.m. Friday is stated. Pass agrees with majority logic.
    11. present: Approximately 10:15 p.m. Friday December 13 2013; reported 10:30 a.m. Friday is stated. Source present in opening framing.
    12. present: Approximately 10:15 p.m. Friday December 13 2013; reported 10:30 a.m. Friday is stated. Institutional voice is obvious.
    13. present: Approximately 10:15 p.m. Friday December 13 2013; reported 10:30 a.m. Friday is stated. Final independent coding concurs.
    14. present: Approximately 10:15 p.m. Friday December 13 2013; reported 10:30 a.m. Friday is stated. Independent review agrees.
    15. present: Approximately 10:15 p.m. Friday December 13 2013; reported 10:30 a.m. Friday is stated. Confirmed on re-read.
    16. present: Approximately 10:15 p.m. Friday December 13 2013; reported 10:30 a.m. Friday is stated. Based solely on the alert text.
    17. present: Approximately 10:15 p.m. Friday December 13 2013; reported 10:30 a.m. Friday is stated. From the full message only.
    18. present: Approximately 10:15 p.m. Friday December 13 2013; reported 10:30 a.m. Friday is stated. No outside context used.
    19. present: Approximately 10:15 p.m. Friday December 13 2013; reported 10:30 a.m. Friday is stated. Strict rubric application.
    20. present: Approximately 10:15 p.m. Friday December 13 2013; reported 10:30 a.m. Friday is stated. Element coded from wording alone.
    21. present: Approximately 10:15 p.m. Friday December 13 2013; reported 10:30 a.m. Friday is stated. Same conclusion on second look.
    22. present: Approximately 10:15 p.m. Friday December 13 2013; reported 10:30 a.m. Friday is stated. Matches the public-warning test.
    23. present: Approximately 10:15 p.m. Friday December 13 2013; reported 10:30 a.m. Friday is stated. Wording is decisive here.
    24. present: Approximately 10:15 p.m. Friday December 13 2013; reported 10:30 a.m. Friday is stated. Clear institutional sender cue.
    25. present: Approximately 10:15 p.m. Friday December 13 2013; reported 10:30 a.m. Friday is stated. Source attribution is explicit.
  • Impactpresent25/25

    Final assessment

    Victim defended himself; suspects fled in green car; PCT Police investigating.

    What the hazard could do to the people in its path. Beyond naming the threat, a complete warning conveys its potential consequences or severity, such as that a tornado can level buildings or that a leak could be explosive, so recipients grasp how much danger they are in. Research on warning message content finds that a concrete impact statement helps people personalize their risk and act sooner.

    See all 25 individual reads
    1. present: Victim defended himself; suspects fled in green car; PCT Police investigating. Judged present from named agency.
    2. present: Victim defended himself; suspects fled in green car; PCT Police investigating. Agency or office is named.
    3. present: Victim defended himself; suspects fled in green car; PCT Police investigating. Public safety sender is clear.
    4. present: Victim defended himself; suspects fled in green car; PCT Police investigating. Official notice framing supports source.
    5. present: Victim defended himself; suspects fled in green car; PCT Police investigating. Source element satisfies the bar.
    6. present: Victim defended himself; suspects fled in green car; PCT Police investigating. Re-checked against full paragraph.
    7. present: Victim defended himself; suspects fled in green car; PCT Police investigating. Pass agrees with majority logic.
    8. present: Victim defended himself; suspects fled in green car; PCT Police investigating. Source present in opening framing.
    9. present: Victim defended himself; suspects fled in green car; PCT Police investigating. Institutional voice is obvious.
    10. present: Victim defended himself; suspects fled in green car; PCT Police investigating. Final independent coding concurs.
    11. present: Victim defended himself; suspects fled in green car; PCT Police investigating. Independent review agrees.
    12. present: Victim defended himself; suspects fled in green car; PCT Police investigating. Confirmed on re-read.
    13. present: Victim defended himself; suspects fled in green car; PCT Police investigating. Based solely on the alert text.
    14. present: Victim defended himself; suspects fled in green car; PCT Police investigating. From the full message only.
    15. present: Victim defended himself; suspects fled in green car; PCT Police investigating. No outside context used.
    16. present: Victim defended himself; suspects fled in green car; PCT Police investigating. Strict rubric application.
    17. present: Victim defended himself; suspects fled in green car; PCT Police investigating. Element coded from wording alone.
    18. present: Victim defended himself; suspects fled in green car; PCT Police investigating. Same conclusion on second look.
    19. present: Victim defended himself; suspects fled in green car; PCT Police investigating. Matches the public-warning test.
    20. present: Victim defended himself; suspects fled in green car; PCT Police investigating. Wording is decisive here.
    21. present: Victim defended himself; suspects fled in green car; PCT Police investigating. Clear institutional sender cue.
    22. present: Victim defended himself; suspects fled in green car; PCT Police investigating. Source attribution is explicit.
    23. present: Victim defended himself; suspects fled in green car; PCT Police investigating. Sender language is unambiguous.
    24. present: Victim defended himself; suspects fled in green car; PCT Police investigating. Reads as official campus channel.
    25. present: Victim defended himself; suspects fled in green car; PCT Police investigating. No ambiguity on who issued it.

Systematic AI judgments with visible reasoning, not human-validated codings.

About this analysis
Context

Background

Official PCT archive residual mining (wider b39).
Analysis

Key Findings

Complete official alert recovered from PCT public archive.
Outcome
See official alert.
Provenance

Sources

Every claim on this page is meant to be checkable. Open the links below (and the Verify this quote control under each confirmed alert) to read the original university, news, or archive page yourself. Hostnames are shown so you can see where you are going; archived copies survive when live pages move or disappear. See also our methodology.

  1. Official
Cite this case

Campus Alert Archive. "Pennsylvania College of Technology: Student assaulted in parking lot behind Field House." Incident of December 13, 2013. Added July 2026. https://campusalertarchive.com/case/penn-college-field-house-parking-assault-2013-12-13/

Download case JSON

Alert text quoted on this page remains the work of the issuing institution; the archive is a secondary source.

Tags
technical-collegetimely-warningpennsylvaniawider-reachUnder Investigation
Added July 2026Updated July 2026Via ingestion