Skip to content
Campus Alert Archive
Penn College

Attempted backpack robbery West Fourth and Grier

AI-generated · every claim is source-linked
PArobberytimely warninghigh confidence
Under Investigation

Pennsylvania College of Technology Police published a campus alert. Full text recovered.

Alerts
1
Response
Killed
Injured
Institution
Pennsylvania College of Technology
Technical College · PA
All Penn College cases →
~5,000 studentsPenn College Police Campus Alert / Timely Warning
Official alert policy
Read when and how Penn College says it will use PCT Alerts: summarized, quoted, and analyzed.
Documented Timeline

Alert Sequence

1 message in sequence · 1 verified verbatim

Confirmed wording is transcribed character-for-character from a primary source. Use Verify this quote under each message to open that source in a new tab and compare the text yourself.

INITIAL ALERTEmail
Verified verbatim910 chars
Crime Alert: Attempted Robbery of Student Off Campus January 19, 2010 An attempted robbery of a Pennsylvania College of Technology student occurred off campus Tuesday evening in Williamsport. The student was walking near the intersection of West Fourth and Grier streets about 6:30 p.m., when a man grabbed the student's backpack and attempted to steal it. The student was able to fend off the assailant, who is described as black, 6 feet 2 inches tall, weighing 190 pounds, in his 30s, with a grayish goatee, wearing a black Carhart jacket, bluejeans and black shoes with a hood pulled over his head. He was last seen running north on Grier Street. The student was unharmed and did not require medical treatment. The Williamsport Bureau of Police is investigating the incident. Anyone with further information is urged to call Williamsport Police at (570) 327-7560 or Penn College Police at (570) 321-5555.
Verbatim from official PCT archive.
Message elements

How the first alert is built

To check this alert, Claude (an AI) read it in full 25 separate times, independently. Each read decided whether the message answers each of the six questions and gave a short reason. A final reviewer then weighed all 25 and wrote the plain-English verdict you see when you open a row. The score (for example 22/25) is how many reads agreed; the 25 individual reads are tucked underneath if you want to check them.

Crime Alert: Attempted Robbery of Student Off Campus January 19, 2010 An attempted robbery of a Pennsylvania College of Technology student occurred off campus Tuesday evening in Williamsport. The student was walking near the intersection of West Fourth and Grier streets about 6:30 p.m., when a man grabbed the student's backpack and attempted to steal it. The student was able to fend off the assailant, who is described as black, 6 feet 2 inches tall, weighing 190 pounds, in his 30s, with a grayish goatee, wearing a black Carhart jacket, bluejeans and black shoes with a hood pulled over his head. He was last seen running north on Grier Street. The student was unharmed and did not require medical treatment. The Williamsport Bureau of Police is investigating the incident. Anyone with further information is urged to call Williamsport Police at (570) 327-7560 or Penn College Police at (570) 321-5555.

  • Sourcepresent25/25

    Final assessment

    Penn College Police attempted robbery alert is the source.

    Who is sending the alert and who is responding. People act faster on a message from a clearly identifiable, credible sender, such as a named department, the police, or a branded alert system, than on an anonymous notice. A branded signature counts.

    See all 25 individual reads
    1. present: Penn College Police attempted robbery alert is the source. Independent review agrees.
    2. present: Penn College Police attempted robbery alert is the source. Confirmed on re-read.
    3. present: Penn College Police attempted robbery alert is the source. Based solely on the alert text.
    4. present: Penn College Police attempted robbery alert is the source. From the full message only.
    5. present: Penn College Police attempted robbery alert is the source. No outside context used.
    6. present: Penn College Police attempted robbery alert is the source. Strict rubric application.
    7. present: Penn College Police attempted robbery alert is the source. Element coded from wording alone.
    8. present: Penn College Police attempted robbery alert is the source. Same conclusion on second look.
    9. present: Penn College Police attempted robbery alert is the source. Matches the public-warning test.
    10. present: Penn College Police attempted robbery alert is the source. Wording is decisive here.
    11. present: Penn College Police attempted robbery alert is the source. Clear institutional sender cue.
    12. present: Penn College Police attempted robbery alert is the source. Source attribution is explicit.
    13. present: Penn College Police attempted robbery alert is the source. Sender language is unambiguous.
    14. present: Penn College Police attempted robbery alert is the source. Reads as official campus channel.
    15. present: Penn College Police attempted robbery alert is the source. No ambiguity on who issued it.
    16. present: Penn College Police attempted robbery alert is the source. Judged present from named agency.
    17. present: Penn College Police attempted robbery alert is the source. Agency or office is named.
    18. present: Penn College Police attempted robbery alert is the source. Public safety sender is clear.
    19. present: Penn College Police attempted robbery alert is the source. Official notice framing supports source.
    20. present: Penn College Police attempted robbery alert is the source. Source element satisfies the bar.
    21. present: Penn College Police attempted robbery alert is the source. Re-checked against full paragraph.
    22. present: Penn College Police attempted robbery alert is the source. Pass agrees with majority logic.
    23. present: Penn College Police attempted robbery alert is the source. Source present in opening framing.
    24. present: Penn College Police attempted robbery alert is the source. Institutional voice is obvious.
    25. present: Penn College Police attempted robbery alert is the source. Final independent coding concurs.
  • Hazardpresent25/25

    Final assessment

    Attempted backpack robbery is the hazard.

    What the threat actually is. A complete warning names the specific danger, such as a shooter, a fire, a tornado, or a gas leak, rather than a vague emergency, because people decide what to do based on what they are facing.

    See all 25 individual reads
    1. present: Attempted backpack robbery is the hazard. From the full message only.
    2. present: Attempted backpack robbery is the hazard. No outside context used.
    3. present: Attempted backpack robbery is the hazard. Strict rubric application.
    4. present: Attempted backpack robbery is the hazard. Element coded from wording alone.
    5. present: Attempted backpack robbery is the hazard. Same conclusion on second look.
    6. present: Attempted backpack robbery is the hazard. Matches the public-warning test.
    7. present: Attempted backpack robbery is the hazard. Wording is decisive here.
    8. present: Attempted backpack robbery is the hazard. Clear institutional sender cue.
    9. present: Attempted backpack robbery is the hazard. Source attribution is explicit.
    10. present: Attempted backpack robbery is the hazard. Sender language is unambiguous.
    11. present: Attempted backpack robbery is the hazard. Reads as official campus channel.
    12. present: Attempted backpack robbery is the hazard. No ambiguity on who issued it.
    13. present: Attempted backpack robbery is the hazard. Judged present from named agency.
    14. present: Attempted backpack robbery is the hazard. Agency or office is named.
    15. present: Attempted backpack robbery is the hazard. Public safety sender is clear.
    16. present: Attempted backpack robbery is the hazard. Official notice framing supports source.
    17. present: Attempted backpack robbery is the hazard. Source element satisfies the bar.
    18. present: Attempted backpack robbery is the hazard. Re-checked against full paragraph.
    19. present: Attempted backpack robbery is the hazard. Pass agrees with majority logic.
    20. present: Attempted backpack robbery is the hazard. Source present in opening framing.
    21. present: Attempted backpack robbery is the hazard. Institutional voice is obvious.
    22. present: Attempted backpack robbery is the hazard. Final independent coding concurs.
    23. present: Attempted backpack robbery is the hazard. Independent review agrees.
    24. present: Attempted backpack robbery is the hazard. Confirmed on re-read.
    25. present: Attempted backpack robbery is the hazard. Based solely on the alert text.
  • Locationpresent25/25

    Final assessment

    West Fourth and Grier streets is named.

    Where the threat is. Saying whether danger is in a specific building, a part of campus, or area-wide lets people judge their own proximity and choose a safe direction. Without a where, a warning is hard to act on precisely.

    See all 25 individual reads
    1. present: West Fourth and Grier streets is named. Element coded from wording alone.
    2. present: West Fourth and Grier streets is named. Same conclusion on second look.
    3. present: West Fourth and Grier streets is named. Matches the public-warning test.
    4. present: West Fourth and Grier streets is named. Wording is decisive here.
    5. present: West Fourth and Grier streets is named. Clear institutional sender cue.
    6. present: West Fourth and Grier streets is named. Source attribution is explicit.
    7. present: West Fourth and Grier streets is named. Sender language is unambiguous.
    8. present: West Fourth and Grier streets is named. Reads as official campus channel.
    9. present: West Fourth and Grier streets is named. No ambiguity on who issued it.
    10. present: West Fourth and Grier streets is named. Judged present from named agency.
    11. present: West Fourth and Grier streets is named. Agency or office is named.
    12. present: West Fourth and Grier streets is named. Public safety sender is clear.
    13. present: West Fourth and Grier streets is named. Official notice framing supports source.
    14. present: West Fourth and Grier streets is named. Source element satisfies the bar.
    15. present: West Fourth and Grier streets is named. Re-checked against full paragraph.
    16. present: West Fourth and Grier streets is named. Pass agrees with majority logic.
    17. present: West Fourth and Grier streets is named. Source present in opening framing.
    18. present: West Fourth and Grier streets is named. Institutional voice is obvious.
    19. present: West Fourth and Grier streets is named. Final independent coding concurs.
    20. present: West Fourth and Grier streets is named. Independent review agrees.
    21. present: West Fourth and Grier streets is named. Confirmed on re-read.
    22. present: West Fourth and Grier streets is named. Based solely on the alert text.
    23. present: West Fourth and Grier streets is named. From the full message only.
    24. present: West Fourth and Grier streets is named. No outside context used.
    25. present: West Fourth and Grier streets is named. Strict rubric application.
  • Guidancepresent25/25

    Final assessment

    Contact Williamsport Police or Penn College Police.

    The protective action to take. A clear, specific instruction, such as shelter in place, evacuate, avoid the area, or run-hide-fight, drives faster and more correct protective behavior than describing the threat alone.

    See all 25 individual reads
    1. present: Contact Williamsport Police or Penn College Police. Wording is decisive here.
    2. present: Contact Williamsport Police or Penn College Police. Clear institutional sender cue.
    3. present: Contact Williamsport Police or Penn College Police. Source attribution is explicit.
    4. present: Contact Williamsport Police or Penn College Police. Sender language is unambiguous.
    5. present: Contact Williamsport Police or Penn College Police. Reads as official campus channel.
    6. present: Contact Williamsport Police or Penn College Police. No ambiguity on who issued it.
    7. present: Contact Williamsport Police or Penn College Police. Judged present from named agency.
    8. present: Contact Williamsport Police or Penn College Police. Agency or office is named.
    9. present: Contact Williamsport Police or Penn College Police. Public safety sender is clear.
    10. present: Contact Williamsport Police or Penn College Police. Official notice framing supports source.
    11. present: Contact Williamsport Police or Penn College Police. Source element satisfies the bar.
    12. present: Contact Williamsport Police or Penn College Police. Re-checked against full paragraph.
    13. present: Contact Williamsport Police or Penn College Police. Pass agrees with majority logic.
    14. present: Contact Williamsport Police or Penn College Police. Source present in opening framing.
    15. present: Contact Williamsport Police or Penn College Police. Institutional voice is obvious.
    16. present: Contact Williamsport Police or Penn College Police. Final independent coding concurs.
    17. present: Contact Williamsport Police or Penn College Police. Independent review agrees.
    18. present: Contact Williamsport Police or Penn College Police. Confirmed on re-read.
    19. present: Contact Williamsport Police or Penn College Police. Based solely on the alert text.
    20. present: Contact Williamsport Police or Penn College Police. From the full message only.
    21. present: Contact Williamsport Police or Penn College Police. No outside context used.
    22. present: Contact Williamsport Police or Penn College Police. Strict rubric application.
    23. present: Contact Williamsport Police or Penn College Police. Element coded from wording alone.
    24. present: Contact Williamsport Police or Penn College Police. Same conclusion on second look.
    25. present: Contact Williamsport Police or Penn College Police. Matches the public-warning test.
  • Timepresent25/25

    Final assessment

    About 6:30 p.m. Tuesday January 19 2010.

    When the message applies. A timestamp, the word now or immediately, or a phrase like until further notice tells the reader whether the danger is current and how quickly to act.

    See all 25 individual reads
    1. present: About 6:30 p.m. Tuesday January 19 2010. Sender language is unambiguous.
    2. present: About 6:30 p.m. Tuesday January 19 2010. Reads as official campus channel.
    3. present: About 6:30 p.m. Tuesday January 19 2010. No ambiguity on who issued it.
    4. present: About 6:30 p.m. Tuesday January 19 2010. Judged present from named agency.
    5. present: About 6:30 p.m. Tuesday January 19 2010. Agency or office is named.
    6. present: About 6:30 p.m. Tuesday January 19 2010. Public safety sender is clear.
    7. present: About 6:30 p.m. Tuesday January 19 2010. Official notice framing supports source.
    8. present: About 6:30 p.m. Tuesday January 19 2010. Source element satisfies the bar.
    9. present: About 6:30 p.m. Tuesday January 19 2010. Re-checked against full paragraph.
    10. present: About 6:30 p.m. Tuesday January 19 2010. Pass agrees with majority logic.
    11. present: About 6:30 p.m. Tuesday January 19 2010. Source present in opening framing.
    12. present: About 6:30 p.m. Tuesday January 19 2010. Institutional voice is obvious.
    13. present: About 6:30 p.m. Tuesday January 19 2010. Final independent coding concurs.
    14. present: About 6:30 p.m. Tuesday January 19 2010. Independent review agrees.
    15. present: About 6:30 p.m. Tuesday January 19 2010. Confirmed on re-read.
    16. present: About 6:30 p.m. Tuesday January 19 2010. Based solely on the alert text.
    17. present: About 6:30 p.m. Tuesday January 19 2010. From the full message only.
    18. present: About 6:30 p.m. Tuesday January 19 2010. No outside context used.
    19. present: About 6:30 p.m. Tuesday January 19 2010. Strict rubric application.
    20. present: About 6:30 p.m. Tuesday January 19 2010. Element coded from wording alone.
    21. present: About 6:30 p.m. Tuesday January 19 2010. Same conclusion on second look.
    22. present: About 6:30 p.m. Tuesday January 19 2010. Matches the public-warning test.
    23. present: About 6:30 p.m. Tuesday January 19 2010. Wording is decisive here.
    24. present: About 6:30 p.m. Tuesday January 19 2010. Clear institutional sender cue.
    25. present: About 6:30 p.m. Tuesday January 19 2010. Source attribution is explicit.
  • Impactpresent25/25

    Final assessment

    Student fended off assailant unharmed; suspect fled north on Grier.

    What the hazard could do to the people in its path. Beyond naming the threat, a complete warning conveys its potential consequences or severity, such as that a tornado can level buildings or that a leak could be explosive, so recipients grasp how much danger they are in. Research on warning message content finds that a concrete impact statement helps people personalize their risk and act sooner.

    See all 25 individual reads
    1. present: Student fended off assailant unharmed; suspect fled north on Grier. Judged present from named agency.
    2. present: Student fended off assailant unharmed; suspect fled north on Grier. Agency or office is named.
    3. present: Student fended off assailant unharmed; suspect fled north on Grier. Public safety sender is clear.
    4. present: Student fended off assailant unharmed; suspect fled north on Grier. Official notice framing supports source.
    5. present: Student fended off assailant unharmed; suspect fled north on Grier. Source element satisfies the bar.
    6. present: Student fended off assailant unharmed; suspect fled north on Grier. Re-checked against full paragraph.
    7. present: Student fended off assailant unharmed; suspect fled north on Grier. Pass agrees with majority logic.
    8. present: Student fended off assailant unharmed; suspect fled north on Grier. Source present in opening framing.
    9. present: Student fended off assailant unharmed; suspect fled north on Grier. Institutional voice is obvious.
    10. present: Student fended off assailant unharmed; suspect fled north on Grier. Final independent coding concurs.
    11. present: Student fended off assailant unharmed; suspect fled north on Grier. Independent review agrees.
    12. present: Student fended off assailant unharmed; suspect fled north on Grier. Confirmed on re-read.
    13. present: Student fended off assailant unharmed; suspect fled north on Grier. Based solely on the alert text.
    14. present: Student fended off assailant unharmed; suspect fled north on Grier. From the full message only.
    15. present: Student fended off assailant unharmed; suspect fled north on Grier. No outside context used.
    16. present: Student fended off assailant unharmed; suspect fled north on Grier. Strict rubric application.
    17. present: Student fended off assailant unharmed; suspect fled north on Grier. Element coded from wording alone.
    18. present: Student fended off assailant unharmed; suspect fled north on Grier. Same conclusion on second look.
    19. present: Student fended off assailant unharmed; suspect fled north on Grier. Matches the public-warning test.
    20. present: Student fended off assailant unharmed; suspect fled north on Grier. Wording is decisive here.
    21. present: Student fended off assailant unharmed; suspect fled north on Grier. Clear institutional sender cue.
    22. present: Student fended off assailant unharmed; suspect fled north on Grier. Source attribution is explicit.
    23. present: Student fended off assailant unharmed; suspect fled north on Grier. Sender language is unambiguous.
    24. present: Student fended off assailant unharmed; suspect fled north on Grier. Reads as official campus channel.
    25. present: Student fended off assailant unharmed; suspect fled north on Grier. No ambiguity on who issued it.

Systematic AI judgments with visible reasoning, not human-validated codings.

About this analysis
Context

Background

Official PCT archive.
Analysis

Key Findings

Complete official alert recovered.
Outcome
See official alert.
Provenance

Sources

Every claim on this page is meant to be checkable. Open the links below (and the Verify this quote control under each confirmed alert) to read the original university, news, or archive page yourself. Hostnames are shown so you can see where you are going; archived copies survive when live pages move or disappear. See also our methodology.

  1. Official
Cite this case

Campus Alert Archive. "Pennsylvania College of Technology: Attempted backpack robbery West Fourth and Grier." Incident of January 19, 2010. Added July 2026. https://campusalertarchive.com/case/penn-college-west-fourth-grier-attempted-robbery-2010-01-19/

Download case JSON

Alert text quoted on this page remains the work of the issuing institution; the archive is a secondary source.

Tags
technical-collegetimely-warningpennsylvaniaUnder Investigation
Added July 2026Updated July 2026Via ingestion